KEGG   Lactobacillus amylophilus: LA20533_01950Help
Entry
LA20533_01950     CDS       T05031                                 

Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
lah  Lactobacillus amylophilus
Pathway
lah00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lah00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LA20533_01950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lah01007]
    LA20533_01950
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lah03016]
    LA20533_01950
Enzymes [BR:lah01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     LA20533_01950
Amino acid related enzymes [BR:lah01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   LA20533_01950
Transfer RNA biogenesis [BR:lah03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LA20533_01950
 Prokaryotic type
    LA20533_01950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1 tRNA-synt_1f tRNA-synt_1d
Motif
Other DBs
NCBI-ProteinID: APT19282
UniProt: A0A1L6XE77
Position
complement(347186..348604)
Genome map
AA seq 472 aa AA seqDB search
MKVFNTLTRTKEEFKPLTEGKVRMYVCGPTVYNYIHIGNARSAIAFDTIRRYLEYRGYDV
TYVSNFTDVDDKMINQARADGITVGELADKYINAFMADTGALNIEPATVNPRATENIPEI
IAFIAKLIENGYAYEVNGDVYYRAKKFAHYGELSDQNIAELETGASQHVNDEELAVKEDP
IDFALWKAQKLSDEISWESPWGQGRPGWHIECSVMSTKYLGETFDIHGGGQDLQFPHHEN
EIAQSEAKTGKKFVNYWLHNGFVTVGQNDEKMSKSLGNFVTVHELLQHVDARSLRFFMAS
TQYRRPIRYTEENLVEAGNVLQRMQNTLDDIAYRLNDSTTSVSSPNLATRLDAALEQFTT
VMDDDFNVQNGLTVVYGMLRHINQEITKAQVDKEQLTRFVTEFKKIMLIFGIEFKDQDTH
LDAQVADLLWQRDAARDEKNFAKSDEIREQLKEMGIVIEDTPQGTRWKRIDD
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagtctttaacaccctgacccgaactaaggaagaattcaagcccctaacagaggga
aaagtacgaatgtacgtctgtggaccgacggtgtacaactatatccacattggtaatgcc
agaagtgctatcgcctttgacacaatcaggcgttacctcgagtatcgcggttatgatgtc
acctatgtgtcaaacttcactgacgttgatgataaaatgattaaccaggcgcgggccgac
ggaattactgtgggtgagctggcggacaagtatattaatgcctttatggcagataccggt
gctttaaatattgagccggcaactgttaatccacgggctacggagaacatcccggagatt
attgcgtttattgctaaattaatcgagaatggctatgcatacgaggtcaatggcgacgtt
tattaccgcgctaagaaatttgcccactacggcgagctctccgaccagaacatcgccgag
ctagagactggtgctagtcagcacgtcaacgatgaggagctggcggtgaaggaagatccc
atcgactttgctctttggaaggcgcaaaagttatcagatgagattagctgggagtcacca
tggggacagggccgtcccggttggcacatcgagtgttcggtgatgtcgactaagtacctt
ggtgagacttttgatattcacggcgggggccaggacctgcaattcccgcaccatgagaat
gaaattgcgcagagcgaagcaaagacgggcaagaaattcgttaattactggcttcataat
ggtttcgtgaccgtgggccaaaatgacgagaagatgagtaagtcacttggtaacttcgtc
acggttcatgagctgttacaacatgtcgatgcacgttcattacgctttttcatggctagc
acacagtatcggcgtccaatacgctatactgaggagaaccttgtggaggccggtaatgtg
ctgcagcggatgcagaatactttggacgatattgcctatagattaaatgacagtaccacg
agtgtgtctagtccaaatcttgctacgagactggatgcggcactagaacaattcaccact
gtgatggatgatgatttcaacgttcagaatggcttgaccgttgtttacggcatgttacgg
cacattaaccaagaaattactaaagcacaagtcgataaggagcaattaacccgcttcgtc
acagagttcaagaaaatcatgttaatctttggtatcgagtttaaagatcaggatactcac
ctagatgcacaggtggcagatttgctctggcaaagagatgcagcccgcgacgagaagaat
tttgccaagagtgacgagattcgtgagcaattaaaagaaatgggtatcgtgattgaagat
acaccacagggaaccagatggaagaggatagatgactaa

DBGET integrated database retrieval system