KEGG   Lactobacillus amylophilus: LA20533_06350Help
Entry
LA20533_06350     CDS       T05031                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lah  Lactobacillus amylophilus
Pathway
lah00071  Fatty acid degradation
lah00072  Synthesis and degradation of ketone bodies
lah00280  Valine, leucine and isoleucine degradation
lah00310  Lysine degradation
lah00362  Benzoate degradation
lah00620  Pyruvate metabolism
lah00630  Glyoxylate and dicarboxylate metabolism
lah00640  Propanoate metabolism
lah00650  Butanoate metabolism
lah00900  Terpenoid backbone biosynthesis
lah01100  Metabolic pathways
lah01110  Biosynthesis of secondary metabolites
lah01120  Microbial metabolism in diverse environments
lah01130  Biosynthesis of antibiotics
lah01200  Carbon metabolism
lah01212  Fatty acid metabolism
lah02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LA20533_06350
   00630 Glyoxylate and dicarboxylate metabolism
    LA20533_06350
   00640 Propanoate metabolism
    LA20533_06350
   00650 Butanoate metabolism
    LA20533_06350
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LA20533_06350
   00072 Synthesis and degradation of ketone bodies
    LA20533_06350
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LA20533_06350
   00310 Lysine degradation
    LA20533_06350
   00380 Tryptophan metabolism
    LA20533_06350
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LA20533_06350
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LA20533_06350
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LA20533_06350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lah04147]
    LA20533_06350
Enzymes [BR:lah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LA20533_06350
Exosome [BR:lah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LA20533_06350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: APT18889
UniProt: A0A0R1YRK5
Position
1211494..1212657
Genome map
AA seq 387 aa AA seqDB search
MKDIFILAAKRTPFGKYNGQLKDFNAVELGEIALKGAVEAAGVSMSDIDSLILGNVISAN
LGQNAARQIALRSGMKESSTALVVNQVCGSSLKAMRIAEGLMNMGDAGIVAVGGSESMTN
APMMTKRVAEPDDENVAVNSMLRDGLIDPLSGQHMGITAENVAAKYHVSRIEQDNFAFES
HQKAYAATANNWFANELIKFEHDGQKIEHDENIRPDTSLDKLASLKPAFKADGIVTAGNS
APLSDGASMMILATAEKVAELELQPIAKITGYAEIGTDPALMGYAPFYAVSKLLESTKTS
VADYDDFEINEAFSAQAVAVQRDLEIPMKKLNIAGGALAIGHPLGATGSRLIATLINNLH
QTSQKKGIAALCIGGGMGIAYAIEVVD
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatttttattttagcagcaaagagaacaccgtttggtaaatacaacggtcaa
ttaaaggattttaacgcagtagagctgggcgagattgccctaaagggagctgtggaagca
gctggagtttccatgtctgatattgattcgctgattcttggtaacgtcatctcggcgaac
ttgggacaaaatgcagcgcgccagattgctttacgcagtggtatgaaagaaagctcaaca
gcattagttgtcaaccaggtctgtggttctagtttgaaggcaatgcgtattgccgaggga
ctgatgaacatgggggatgctggtatcgttgcggtcggtggcagtgagagcatgaccaac
gcgccaatgatgaccaagcgagtggcagaacccgatgatgagaacgtagcggttaacagc
atgctgcgtgatggtttgattgatccacttagtgggcaacacatggggattaccgctgaa
aatgtggctgcaaagtatcatgtttcaagaattgaacaggataattttgcctttgaatca
caccaaaaagcgtatgctgcgacggcgaacaattggtttgcaaatgagttgattaaattc
gaacatgacggccagaagattgaacacgatgagaatattcgtccggatacaagtctagat
aaacttgctagcctaaagccggcctttaaagctgatggaattgtgacggccggtaattca
gcacctctgagtgacggcgcatccatgatgattttagccactgccgagaaggttgcagaa
ctagagttacagccaattgccaaaataactggatatgccgagattggtactgatccagct
ctgatgggctatgcaccattctacgcagtatctaagttgcttgagtcaaccaagacctca
gttgccgattatgatgattttgagatcaacgaagcattctcagcgcaggcagttgccgtg
caacgcgacttggaaattccaatgaagaaactaaatatcgccggtggtgctttggcaatt
ggtcatccgcttggcgcgactggtagccgactgattgcaacgctgattaacaacttacat
caaacatcccagaagaagggaattgctgcactttgtatcggcggaggaatgggcatcgct
tacgcaatcgaagtggttgactaa

DBGET integrated database retrieval system