KEGG   Lactobacillus amylophilus: LA20533_07240Help
Entry
LA20533_07240     CDS       T05031                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
lah  Lactobacillus amylophilus
Brite
KEGG Orthology (KO) [BR:lah00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LA20533_07240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: APT19050
UniProt: A0A0R1YK66
Position
1379959..1380972
Genome map
AA seq 337 aa AA seqDB search
MNIALIVTIALVMGVVFVNGWTDAPNAIATAVSTRVLRPNVAIWMAVVMNFLGALVMTFF
NAKVAETISNIVSFDGAGNASQVALSAALFAIVTWAVAAWWFGIPTSESHALVAGLTGAA
MALGGLNAVNVDEWWKVIIGLIVSTILGFGGGYLITKLIIWIFQGVNRIFANKIFTGGQA
FGAAAMAFLHGAQDGQKFMGVFMLTLFYNGLVEKSGNGFAIPIWVMVLCSVTMGIGTSVG
GMRIIKSVGMDMVKLQKYQGFSADVAAAITLLLSSIFGIPVSTTHTKTTAIMGAGAAKRL
SSVDLTVVKNMVLAWVLTFPGCGIIAFLMAKLFMAIF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgctttaattgttaccattgcgctggtgatgggcgtcgtgttcgtcaatggt
tggaccgatgcaccgaatgccattgctaccgcagtttcaactcgcgtgttgcgcccgaat
gtggcgatttggatggctgtcgtcatgaacttcttgggggcgctcgtgatgaccttcttc
aacgccaaggtggccgagaccatcagcaacatcgtgagtttcgatggggccggtaacgcc
agtcaggttgccctgtctgccgcgctatttgctatcgtgacctgggcggtcgctgcatgg
tggtttggcattcctacgagtgaatcacacgcgctcgttgctgggctcaccggtgccgca
atggctcttggtggcttgaacgccgtcaatgtggacgaatggtggaaggtcatcattggc
cttatcgtcagcactatcctaggctttggtggtggctatttgattactaagctcatcatc
tggattttccagggagtcaaccggatcttcgccaacaaaatttttactggtgggcaggcg
tttggcgccgcagccatggcgtttctccacggcgcccaagatgggcagaagttcatgggt
gtcttcatgttgaccctcttctacaacggcctcgtcgagaagagcggtaacggctttgcc
attcccatctgggttatggtgctctgttccgtgaccatgggaatcggtacgagcgtcggc
gggatgcgcatcattaagtccgtcggcatggatatggtgaagctgcagaaatatcagggt
ttctcagccgacgtggcggcagcaatcacgctgctactatcctcaatcttcggtattcct
gtgtcgacgacacacactaaaacaacggcaatcatgggtgctggtgcagccaagcgcctc
tcgagtgtcgatctcaccgttgtgaagaacatggtactcgcctgggtactcacgttccct
gggtgtgggattatcgcttttttgatggcaaaattatttatggcaattttttag

DBGET integrated database retrieval system