KEGG   Lactobacillus acidophilus 30SC: LAC30SC_02415Help
Entry
LAC30SC_02415     CDS       T01436                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
lai00430  Taurine and hypotaurine metabolism
lai00620  Pyruvate metabolism
lai00640  Propanoate metabolism
lai00680  Methane metabolism
lai01100  Metabolic pathways
lai01120  Microbial metabolism in diverse environments
lai01200  Carbon metabolism
Module
lai_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:lai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LAC30SC_02415
   00640 Propanoate metabolism
    LAC30SC_02415
  09102 Energy metabolism
   00680 Methane metabolism
    LAC30SC_02415
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    LAC30SC_02415
Enzymes [BR:lai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     LAC30SC_02415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ADZ06663
UniProt: F0TJ06
Position
495064..496257
Genome map
AA seq 397 aa AA seqDB search
MKKVLAINSGSSSFKFKLFSLPDEKVVAFGMADRVGLPGASFKIALQDGNEHIEHVEVPD
QEAAVSLLLKALKKYHVVEDLNEIVGVGHRVVSGGEIFKDSTVVDQEVLQKIKDLSNFAP
LHNPAEARGIEAFMHVLPKVPQVAVFDTSFHQTLDPVHYLYSIPYDYYKEYGARKYGAHG
TSVHYVTLEAAKMMKKDLKDLKLITCHLGSGSSITAVKNGKSYDTSMGFSPLSGITMGTR
SGDIDPSLLQHLMHETGISMNEMINILNKKSGLLGISGISSDMRDLKYNKNPRAVLARKI
FLNRIVRYIGAYIAEMGGVDGIVLTAGVGEGDVGMRQAIMDAFKYMGVNPDYEANKTNGQ
KFITKPDSSIQVMVIPTNEELMIARDVMRLTKCAVLA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggttctggcaataaattcaggcagttcatcatttaaatttaaattattctct
ttgcctgatgaaaaggtagtggcattcggtatggctgatcgtgttggcttacctggggct
agctttaagattgccttgcaagatggcaatgaacatattgaacatgttgaggtccctgat
caagaagctgcagtaagtctactgcttaaagctttaaagaaatatcatgtagttgaagac
ttaaacgaaatcgttggcgtaggacaccgtgtagtgagcggtggcgaaatcttcaaggat
tctactgtagttgatcaagaggttttgcaaaagatcaaagacttgtcaaactttgcccca
ctgcataacccagcagaagcacgcggaatcgaagcatttatgcatgttttgcctaaggtg
ccacaagttgccgtgtttgatacttctttccatcaaacgctggatcctgttcattattta
tactcaattccttatgactactacaaggaatacggtgcacgtaaatatggtgctcacggc
acatctgtccactatgtaactttagaagctgctaagatgatgaagaaggatctgaaagac
cttaaattgattacctgccacttaggttctggctcatcaatcactgcagttaagaatggt
aagtcatatgacacctcaatgggcttcagtccactttctgggatcactatgggtactcgt
tcaggcgacatagatccatcgcttttgcagcacttgatgcatgagaccggcatttcaatg
aatgagatgatcaatattttgaataaaaaatctggtttacttggcatttcaggcatttca
tcagatatgcgcgatttgaaatacaacaagaatccacgtgcagtccttgctcgtaagatc
ttccttaaccggattgtccgctatattggtgcatatattgctgaaatgggcggtgtcgat
ggtatcgtgcttactgctggcgttggtgagggcgacgtaggcatgcgtcaagcaattatg
gatgcctttaagtacatgggcgtaaaccctgactacgaggctaataagaccaatggacaa
aagtttattactaagccagactcttcaattcaggtgatggtaattccaaccaatgaagaa
ttaatgattgctcgcgatgtcatgcgtcttactaagtgtgccgttttagcataa

DBGET integrated database retrieval system