KEGG   Lactobacillus acidophilus 30SC: LAC30SC_03140Help
Entry
LAC30SC_03140     CDS       T01436                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
lai00071  Fatty acid degradation
lai00072  Synthesis and degradation of ketone bodies
lai00280  Valine, leucine and isoleucine degradation
lai00310  Lysine degradation
lai00362  Benzoate degradation
lai00620  Pyruvate metabolism
lai00630  Glyoxylate and dicarboxylate metabolism
lai00640  Propanoate metabolism
lai00650  Butanoate metabolism
lai00900  Terpenoid backbone biosynthesis
lai01100  Metabolic pathways
lai01110  Biosynthesis of secondary metabolites
lai01120  Microbial metabolism in diverse environments
lai01130  Biosynthesis of antibiotics
lai01200  Carbon metabolism
lai01212  Fatty acid metabolism
lai02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LAC30SC_03140
   00630 Glyoxylate and dicarboxylate metabolism
    LAC30SC_03140
   00640 Propanoate metabolism
    LAC30SC_03140
   00650 Butanoate metabolism
    LAC30SC_03140
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LAC30SC_03140
   00072 Synthesis and degradation of ketone bodies
    LAC30SC_03140
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LAC30SC_03140
   00310 Lysine degradation
    LAC30SC_03140
   00380 Tryptophan metabolism
    LAC30SC_03140
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LAC30SC_03140
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LAC30SC_03140
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LAC30SC_03140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lai04147]
    LAC30SC_03140
Enzymes [BR:lai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LAC30SC_03140
Exosome [BR:lai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LAC30SC_03140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADZ06800
UniProt: F0TDK6
Position
648991..650151
Genome map
AA seq 386 aa AA seqDB search
MKDIYIVAAKRTPFGKYRGFFKDTSAIELGVMALKGTLKAGNINPQDVQALFMGNVLGTG
LGENMARQVALNSGMKQESAAVTINEVCGSSLKAVRLAQGQMEMGDLDLVAVGGSENMTR
APYFVKKEYKADPADHLTSTMINDALMDAFSGKHMGITAENVAERYHVSRKEMDEFSLRS
HQLATKATKSGLFKNEILKVELNGQILDHDESIRPDTSLEALSNLKPVFKEDGQVTAGNS
SPLNDGASMLVLATKEKMEELHLTPIAKLGAFAEAGFDPAYMGYTPYYAVKKLLAKTGRK
IDDYDIIELNEAFAAQGLAVARDLHIPMDKLNIMGGAIALGHPLGATGTRLVASAISGLK
NRNGKRALVTLCIGGGQAVAYEIENA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggatatatatattgttgcagccaaaagaacaccttttggcaagtatcgtggcttt
tttaaggatacttccgcaattgagttgggagtaatggcattaaaggggactttgaaagcg
ggaaatattaatccgcaagatgttcaagctctttttatgggtaatgttttaggtacaggt
cttggtgaaaatatggcccgtcaagttgctcttaattcagggatgaagcaagagtcagct
gcagtgacaatcaatgaagtttgtggttcaagtttaaaggctgttcgtttggcccaaggt
caaatggaaatgggcgacttggatttggtagctgttggtggtagtgaaaacatgacacgc
gcaccatactttgttaaaaaagaatacaaggctgatccagcagatcacttaaccagtacg
atgatcaacgatgccttaatggatgctttttctggcaaacacatgggaattacagctgaa
aacgttgctgagagatatcatgtttcgcgcaaagaaatggacgaattcagtttacgttca
caccaacttgcaacaaaagcaactaaatctggccttttcaaaaatgaaattttaaaggtt
gaacttaacggtcaaatcttggatcatgatgaatcaattcgtcctgatactagtcttgaa
gccttaagcaacttaaagcccgtctttaaggaagatggtcaagtaacagccggcaattca
tccccattgaatgatggtgccagcatgttagtacttgctactaaagaaaagatggaagaa
ttgcatttaactccaattgctaagttaggtgcatttgcggaagccggttttgatccggct
tacatgggctatactccttactatgccgttaagaagttgttagctaagactggccgcaaa
attgatgattacgacatcatcgaattaaacgaagcttttgctgctcaaggccttgcagtg
gcaagagacttgcacattccaatggataaattgaatattatgggcggcgcgattgcatta
ggtcacccattaggtgcaacaggtacgcgtttagtagcttccgcaattagtggattaaag
aatagaaatggcaagagagctttggttaccttgtgtatcggtggtggccaagcggttgct
tatgaaatcgagaatgcctaa

DBGET integrated database retrieval system