KEGG   Lactobacillus acidophilus 30SC: LAC30SC_06785Help
Entry
LAC30SC_06785     CDS       T01436                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lai  Lactobacillus acidophilus 30SC
Pathway
lai00260  Glycine, serine and threonine metabolism
lai00750  Vitamin B6 metabolism
lai01100  Metabolic pathways
lai01110  Biosynthesis of secondary metabolites
lai01120  Microbial metabolism in diverse environments
lai01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lai00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LAC30SC_06785
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LAC30SC_06785
Enzymes [BR:lai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LAC30SC_06785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ADZ07479
UniProt: F0TFI5
Position
1313313..1314812
Genome map
AA seq 499 aa AA seqDB search
MKYRSTRGAKDNALTSPAAIIQGLAQDGGLYVPVDFPKANFQLEDLPKLSYKQISAMIIS
LFFDDFSKDQIKSAVINAYSEQWDDRSIVPIEKHNDNFYMELFHGPTLAFKDIALQMLPQ
LMTRAVQIEKIDRDIIILTATSGDTGTASMRGFANQKGTRVIVFYPEGGVSPVQLKQMLS
QHGDNLEAIAIKGNFDDAQTEVKKIFNDENFRKKLNQNGFQFSSANSMNIGRLVPQISYY
LYTYGQLVRRREINLGDKVNFTVPTGNFGDILAGYYAEKLGLPINKLICASNENNVLTDF
FAKGEYDKRRKFHLTNAPAMDILVSSNLERLLFDLYDKDNEKIASLMNQLTQRGHYQVDK
EVLDKLQTIFAAGFATEDEVKEEIHRVYNYDRYVIDPHTAVGSYVAQQYKSKTNDQTPMV
IVSTASPYKFPETVYEAITGRVCPQTGVAAIKKLHDELGGQLSIGVRTLFDHEPHVEKVI
DPVNMEAAISSILDLKQFI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatcgtagtactcgaggcgcaaaagacaatgcgttaacttcaccagccgcaatc
atccaagggttggcccaagatggtggactttatgtaccagtagattttccaaaagctaat
tttcaactagaagatttacctaagttatcttataagcaaatttcagcaatgatcattagc
ttattttttgatgatttttctaaggatcaaattaaatctgcagtaatcaatgcttatagc
gaacaatgggacgaccgcagcattgtgccaattgaaaaacacaacgataatttttacatg
gaactctttcacggtccaactttagcttttaaagatattgctttgcagatgttaccacag
ctaatgacacgtgcagtacaaattgagaaaatcgatcgtgacatcattatcttgactgct
acttctggtgacaccggaactgcttcaatgcgtggctttgctaaccaaaaaggtacacgc
gtcatcgtcttctatcctgaaggcggcgttagccctgtccaacttaaacaaatgctcagt
caacacggcgacaatttggaagccatcgcgatcaagggtaactttgacgatgcgcaaact
gaagtaaagaagatttttaacgatgaaaacttcagaaagaaactaaaccaaaacggtttc
caattctcatctgctaactcaatgaacattggtcgtcttgttcctcaaatttcttattac
ctttacacttatggtcaattggttcgccgtcgtgaaatcaacttgggcgacaaagtaaac
tttaccgtacctacaggcaatttcggcgacattttagctggttactatgcagaaaaactc
ggtttgccaatcaacaaattgatctgtgcttcaaatgaaaacaacgttcttactgacttt
tttgccaaaggtgaatacgacaagcgtcgtaagttccatttaactaacgcaccagcaatg
gatattttagtttcaagcaatctagaacgacttttattcgatttatatgataaagataat
gaaaaaattgctagtctaatgaatcaattaacgcaaagaggtcattaccaagtcgacaaa
gaggtcttagacaaattacaaactatttttgcggctggttttgccactgaagatgaagta
aaagaagaaattcaccgcgtctacaattatgatcgctacgtaattgatcctcatactgca
gtaggttcatacgttgctcagcaatataagagcaagacaaacgatcaaacaccaatggtg
attgtgtctactgctagtccttataagttccctgaaaccgtttatgaggctattacaggt
agagtttgtcctcaaactggcgtagctgccattaagaagttgcatgatgaattgggtggt
caattatccatcggtgtacgcaccttgtttgaccacgaaccacacgttgaaaaagtaatt
gatccagtcaacatggaagcagctatcagttcaattttagatttaaagcaattcatttag

DBGET integrated database retrieval system