KEGG   Leptospira alstonii: A0128_03975Help
Entry
A0128_03975       CDS       T04558                                 

Definition
(GenBank) exodeoxyribonuclease V subunit gamma
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
laj  Leptospira alstonii
Pathway
laj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:laj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    A0128_03975
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:laj03400]
    A0128_03975
Enzymes [BR:laj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     A0128_03975
DNA repair and recombination proteins [BR:laj03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     A0128_03975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C KH_dom-like DUF3293
Motif
Other DBs
NCBI-ProteinID: AOP33090
UniProt: A0A1D7UU09
Position
1:complement(834803..838222)
Genome map
AA seq 1139 aa AA seqDB search
MSVTHITSLSLEDIAVELSKNILAERKVAPLHAPVIVIPSTNMKLWLNLNLSRINGLTAN
LRFQFLEKTLEEFYLRRAGFDFDPFHRTFPSQEANQRKILTFLIENRDQKEIRFLNSFLQ
SIPRAFSLSSKLTSLIKDYELNRSSWISSWAKEKGIEIPSISHRPSPFPKEDEYYLFQKE
LYQKVFLNPKEPSTLVQFLLKEAQKNPNHSPKEFPSLHLFCLSNLSDTYLGILESLSKRD
RLPIYLYQFHTGANRNHKDSFGPRSWSNPQIHIAARMEKIEGNTSTHLETSHTFPPKLDA
LRTLLDGKQNTREQIGIASDTSVRFWNAPSAYREMEAVANDILYKMNLNSKLTYLDFAIL
VTDMKTYRPTVEWVLDGGILLQSSQNEKAVDPFPVRKKIPYSLTDIKANDASLLYRGLIN
VWEICSSPTIEKNSLLRLLRNPLLQTKLRIHPQSILDLENLIDSTGMIYEEEGRENDSFQ
ISNGMRRIRLSSILSKETAWTKYKIPPIDLESEENSFYLTQLWETILRTKRNVLSIFKNK
TNQWNPEYFRILRNSLEELFEFSEEYEQEAKLFFGWLESLNEWDGIRLQNEKDGVALLKF
ITEQTFDQIPYRKGAYLTGGVTISLLQPMRPIPFKHIYILGLGEGKFPGNNDRSQLNLRK
DLREEWDISRREIQESLLWETIHSAKESLTLSYVGKNLQEDKTFEPCSHLFEIMESFGVQ
EAIKLPLHSYSIKYKHTQEEMAQGLVSFDFARTWVNGDRRGQKLFDRFQNLDDLKKVSTD
FPVNEIDLREISQFLSDPLDTYLKKKLGMYLDEEEPADAEGEPFDLDAIAEANILKKMHA
VMMPSLVSKEPWSWNEETISSALIPILEKEKQSARFPQSVFGKIQEADLLGYLKLTSELL
AGWKPLFQGGRYYSYLSLGDTGLPEDLCKKIPELTVSLQSGKNVKIKGEWEHVVEKDGVL
YWLFPKSLEDKPSENFYGYKDYWKVMSFPFLTGVAFSTLGENFKIYSFKARPSEDAKKKN
FLPIQYLPEESALGQEYFQKIAELYLQEKPVFFPRKAFLSYYVKNIQGSSGKKTTPDNVA
KFDDENAWKNYLKEELDSVRESLSSLVKLYRQTPDLILRSSIHWAKDFYKPFLDWKKDL
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagtcacgcatatcacaagtctatcgctcgaagatatcgcggtcgaactctcaaaa
aatattttggcggagagaaaggtagctcccttgcacgcacccgtgatcgtgattcccagc
acgaacatgaaactctggttgaatctcaatctttctcgtatcaatggactgactgccaat
cttcgttttcaattcttagaaaaaactcttgaagaattttatctccgaagagccggtttt
gattttgatccgtttcatcgaaccttcccgagtcaagaagcgaatcaaagaaagattcta
accttcctgatcgaaaatcgagatcaaaaagaaattcgttttctaaattctttcttacag
agtattcctcgggcgttttcgctcagctcaaaactgacttcgcttatcaaagactacgaa
ttaaatcgatcgagttggatttcttcttgggcgaaagaaaaaggaatcgaaattccttcg
atctcacatcgcccttctccttttccaaaggaagacgaatattatctttttcaaaaagaa
ctctatcaaaaagtttttctcaatcccaaagaaccgagcaccttggttcagtttcttttg
aaagaagcacaaaaaaatccgaatcattctccaaaggaatttccttctcttcatcttttc
tgtttgtccaatctttcggatacgtatcttggaattttagaatcactttccaaacgggat
cgacttccgatctatctctatcaatttcatacgggagcaaaccggaatcacaaagattct
ttcggtcctcgaagctggtccaatcctcagattcatatagccgcgagaatggagaagatc
gaaggcaacacttcgactcatctcgaaacctctcatacgtttcctccaaagttagacgcg
cttcggactttactggatggaaaacaaaatacaagggaacaaatcggaatcgcatcggac
acgtcggtgcggttttggaacgcgccttccgcgtatcgtgaaatggaagcagtcgcaaac
gacattctttataagatgaatctgaattctaagttaacgtatttggattttgcgatcctc
gtgacggatatgaagacctatcgtcctaccgttgaatgggtgttagacggaggaatcctt
ttacaaagttcacaaaacgaaaaggcggtcgatccgtttcccgttcgtaaaaaaattccg
tattccctcacggacatcaaggcaaacgacgcgtccttattgtatagaggtttgatcaac
gtctgggaaatctgctcgagtcctacgattgaaaaaaacagcctactccgtttacttaga
aaccctcttttgcagacaaagcttagaattcatccacaatcgattttggatctggagaat
ctaatcgattctaccgggatgatctacgaagaagaaggacgtgaaaacgattcctttcag
atttcgaatggtatgagaagaattcggttgtcctcgattctatcgaaggaaactgcgtgg
acaaaatacaaaattcccccgatcgacttggaatccgaagaaaattctttctatctcacg
caactctgggaaacgatccttagaacaaaaagaaacgtcctttccatcttcaaaaataaa
accaaccaatggaatccggaatactttagaatattaagaaattctttagaagaactcttt
gaattttcggaagaatacgaacaggaagcgaaactttttttcggatggctggaatctctc
aacgaatgggacggaatccgtctccaaaacgaaaaagacggagtcgctcttctcaagttc
atcacggaacagactttcgatcaaatcccgtatcgaaagggtgcctacctcaccggcgga
gttacgatttctcttttacaaccgatgcgcccgattccattcaaacacatctatatctta
ggattgggagaaggaaaatttccgggaaacaacgatcgatcccaactcaacctcagaaaa
gatctcagagaagaatgggacatttcccgcagagaaatccaagaatctcttttgtgggaa
accattcattccgcgaaggaatctctgaccttgagttatgtgggaaaaaatctccaagaa
gacaaaaccttcgaaccttgttctcatcttttcgagatcatggaatcttttggagttcaa
gaagcgatcaaacttccgttgcattcgtatagtataaaatacaaacatacccaggaagag
atggcgcagggcctcgtgagcttcgactttgcaaggacctgggtaaacggagatcggcgc
ggccaaaaacttttcgatcgatttcaaaatctcgacgatttaaaaaaagtttctactgat
tttccagtgaacgaaatcgaccttcgtgaaatttcccaattcctcagcgatcctctcgat
acttatctcaaaaaaaaattagggatgtatctggacgaagaagagccggccgatgccgaa
ggagaacctttcgacttggatgcgatcgccgaagcaaatatattaaaaaaaatgcatgca
gtaatgatgcctagcctcgtatcgaaagaaccttggtcctggaacgaggaaacgatctct
tccgccctcattcctattttagaaaaagaaaaacaatcggctcgatttcctcagtcagtc
ttcggaaaaatccaagaagccgatctactaggatatctcaagcttaccagcgaactcctc
gcaggttggaagccgctcttccaaggcggaagatattattcttatttgagtttgggagat
acgggtctgcccgaagatctttgtaaaaaaattccggaacttaccgtttccttacaatcc
ggtaaaaacgtaaagatcaaaggagaatgggagcacgtcgtcgaaaaagacggagttctc
tattggctttttccaaagagcctcgaagacaaaccttccgaaaacttttacggctacaag
gactactggaaagtcatgagttttccgtttcttaccggagtcgccttttctacgttaggc
gagaattttaaaatttattctttcaaagcgcggccttccgaggacgcaaaaaagaaaaac
tttcttcccatacaatatttgccggaagaatccgcactgggacaagagtactttcaaaaa
atagcagaactctatctccaagagaagccggtcttttttccgagaaaagcttttctgagt
tactatgtaaaaaatatacaaggaagctccggaaaaaagacaacgccggataacgtagca
aaattcgacgacgagaacgcgtggaaaaattatctcaaagaagaattggattccgtaaga
gaaagcctttcttctcttgtaaaactctatcgtcaaacaccggacttgatcttacgttcc
tcaatccactgggcaaaagatttttataaacctttcttagattggaagaaggatctatga

DBGET integrated database retrieval system