KEGG   Leptospira alstonii: A0128_05225Help
Entry
A0128_05225       CDS       T04558                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
laj  Leptospira alstonii
Pathway
laj00471  D-Glutamine and D-glutamate metabolism
laj00550  Peptidoglycan biosynthesis
laj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:laj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    A0128_05225
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A0128_05225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:laj01011]
    A0128_05225
Enzymes [BR:laj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     A0128_05225
Peptidoglycan biosynthesis and degradation proteins [BR:laj01011]
 Precursor biosynthesis
  Amino acid ligase
   A0128_05225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AOP33300
UniProt: A0A1D7UUK9
Position
1:complement(1091785..1093173)
Genome map
AA seq 462 aa AA seqDB search
MKFPESLKDQKTLVLGGGISGNSALDLLITLGADPILCDRNPPTSSRIAFLSDSTEPNSL
PPISLIIKSPGILPTHPILLFAKEKGIPVFSEIDLGRHFFQGRIIGITGTDGKSTTTALT
AHLLKKDFPDLREGGNLGIPFTSFCKEPISLAVLELSSYQLDDSSPLQLNASVFLNLAPD
HLERHKTMENYFQAKLKIADLKNQNHSLIVSQKIKERILNTVEFQCKLLSFGRIPEADAF
LDENSLKIRTAKFEYDLSLFHLPGTHNRENLAASILAAEAIGGKPESIQYQIPLFKGLPH
RFQIAGEKNGFSFINDSKSTNLHSMLAGMSTWKKREHTCLILGGRPKQEDPKPLYDFLIQ
GIGCVILIGEGRPVWEEGIRKLIGAKLFAVETLEEAFTILKNGKTNSSPTQEETFQIHLE
NGIQISSVVFSPACASFDQYKNFEERGNHFLSLVESFLKEDR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcccgagtccctaaaagaccagaagactctcgttcttggtggaggaatctcc
ggaaattctgcattggatcttttgatcactctgggagcggatcccattctctgtgatcga
aaccctccgacttcaagccgaatcgcttttctttcggattctaccgaacccaattctctt
cctccaatctctcttatcataaagtctccgggtattttaccaactcatccgattcttctc
tttgcaaaagaaaaaggaattcctgtgttttcggaaatcgatctcggaagacatttcttc
cagggaagaatcataggaatcaccggaacggacgggaagtcgacgacgactgcgctcacg
gctcatcttttgaaaaaggattttccggatctgagagaaggcggcaatctcggaattcca
ttcacttccttttgtaaggagccgatctcgttagcggttctcgaactttccagctatcaa
ttagatgactcctctcctctccaattaaacgcgtccgtatttttaaatcttgcacccgat
catttagaaagacacaagactatggaaaattatttccaagcaaagttaaagatcgcggat
cttaaaaatcaaaatcattctctgatcgtttcgcagaagatcaaagaaagaatcctgaac
accgtagagtttcagtgtaaacttttgagttttggaagaatcccggaagcggatgcgttc
ttagatgagaattctctgaagatccgtactgcaaaattcgaatacgatctttctctgttt
catcttcccggaactcacaatcgagagaatctcgcggcttccattcttgcagccgaagcg
atcggaggaaaaccggaatcgattcaatatcagatcccactcttcaaaggtcttccacat
cgttttcaaatcgcaggagagaaaaacggcttttcgtttatcaacgattctaaatcgaca
aatcttcatagtatgctcgcgggaatgtccacttggaagaaacgagagcatacctgtctc
attttaggcggaaggccgaaacaagaggacccaaaaccactttatgatttcctaatacaa
ggaatcggctgtgtgattctcatcggggaaggccgtcccgtttgggaagaagggattcga
aaactcatcggagccaaactcttcgcagtggaaaccttagaggaagcttttacgatccta
aagaatggaaaaacaaattcatcccctactcaagaagaaacttttcaaattcatttagag
aatggaatccaaatctcttcggtcgttttttctcccgcttgcgcgagcttcgatcaatat
aagaattttgaagaaagaggaaatcactttctttctctcgttgaatcctttctgaaagaa
gacagataa

DBGET integrated database retrieval system