KEGG   Lingula anatina: 106150437Help
Entry
106150437         CDS       T04921                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
lak  Lingula anatina
Pathway
lak03013  RNA transport
Brite
KEGG Orthology (KO) [BR:lak00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    106150437
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lak03012]
    106150437
Translation factors [BR:lak03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    106150437
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 106150437
NCBI-ProteinID: XP_013378702
UniProt: A0A1S3GYG1
Position
Unknown
AA seq 1174 aa AA seqDB search
MPTYFQRPENALKRANEFIDVGKKQRALDALYDVIKSKKHRTWQKIHEPIMEKYLVLCVE
LKKSHVAKEGLYQYKLICQQVNIKSLEDVVRKYLALAEDKTEEARAQSHQAVVDIDDLDV
IQTPESLLLSAVSGEDSQDRSDRAILTPWVKFLWESYRQCLDLLRNNSRVEKLYQDIAQQ
AFKFCLKYQRKTEFRKLCDNLRTHLGHIHKHQHQQTAINLNNPESQAMHLETRLVQLDSA
IQMELWQEAFKAVEDIHGLISLSKKPPKPSLMANYYQKLGLVFWKAGNRLFHACALHRLF
HLSREQRKNLSPEEQQKMASRVLCATLAVPILPSRNPIDQLLEVDSTTLEKQRRLATLLG
LQTPPNRTALIKDLVKYSMLQHVHPEVQNLYRWLEVDFHPLKLSQRVASSMEYIENNEDL
CQYESALHEITITRLLKQISQVYQTIEFARLAKLAPFANKFQLERVIVDSARRLELQIRI
DHRTKSLSFGMDLGVAQKEDVPEGPYLQSMPSEQIRNQMTNMAQALHKAVNMIKPEGKKK
KEEEIKEHIVTAYRQTSAREHQRILSRRQIIEDRKELLESLSVQREREELQKEEEIRSKA
HAAEMARLEREAEERERQRRVEEQKEIQKKHAKERLKQLKETELGAKAFKDLHEEDIVEL
DADEILARQVEQLEKEKKELQERLNAQSKKVDHLARAKCLEEIPLLKQQYEEEKVKLREF
WEQEEQERIEKIMAEREMALEHSDRLKRMMEDKDAFLKKIAQARMSVYKEKLAEFNKKLA
EERKKRLQKRKEMRIKERRQKRQEEKEEAEQRAREEAMKREREEKERIEREQREEEERQY
EEKMRKLEEIAEKQRQKEREIEEREAKRREEIRGQDDRGGDQREERGGAWRAPVRGGGWR
EREKERELSWKKRDDGDGGREHDWRRGEGPRIERDFRRDEPRDLRKDERGPDRDFRRDDR
GPPDRDMRRDDRGPDRDFCRDASPRGGFGRGGDDGRPPARDDRDWGRRGDDRDWGRREPP
RDDWRRGPPARDERDSRMPYRDIREEHRDSRMPARDIREERDGRMPARDIREDRDSRMPA
RDIREDRDFGRRDGPPRDDWRRGPPRDDRDGGGWRRGGDERGPPSRDDWGGRGGGRDMRG
AGRNEEREWRRGDTKDAPSRDKRGDGDEWTTVKY
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atgcctacatattttcagcgaccagaaaatgctcttaaaagagcgaatgaatttattgat
gttggtaaaaagcaacgggctcttgatgctctctatgatgttatcaagagtaagaagcat
cgaacatggcagaaaatccatgagcctatcatggagaaatatctagttctttgtgtagaa
ctaaagaaaagccatgtcgctaaagaaggactgtaccagtacaagcttatatgtcagcag
gtcaatattaagtcacttgaggatgtggtgcgaaagtacctggccctagccgaggacaag
actgaagaagccagggcacagtcacatcaggctgttgttgatattgatgatctggatgtc
atacaaaccccagagagtctgttactgagtgctgtgagtggagaagactcccaagatcgt
tctgatagggctattctgaccccttgggtaaagtttctgtgggagtcctaccgtcaatgt
ctggatttacttagaaataattccagggtagaaaagttgtaccaggacattgcacagcaa
gctttcaagttttgcctgaagtaccaaaggaagaccgaatttagaaaattgtgtgacaac
cttcgcactcacttgggtcacatccacaagcaccaacaccagcagactgccatcaacctg
aacaacccagagagccaggccatgcacctggagacacgcctagtacagctggatagtgct
atccagatggaactctggcaggaagccttcaaagctgtggaggacattcatggtttgatc
agtttgtccaagaagccacccaagccatctcttatggccaattactaccagaagttgggt
ttagtattctggaaggctggcaatcgtctcttccatgcctgtgctctacatcgactgttc
catctatccagggaacaaaggaagaacttgtcccctgaggagcagcagaaaatggcatct
cgtgtgctttgtgccacactagctgtgccaattcttccctcacgcaacccaattgatcag
ctgctggaagtagactccactacactggagaagcaaagacgtctggcaacactgcttggt
ctgcagacaccacctaacagaacagctctaattaaagatttggtgaagtacagcatgctc
caacacgtgcaccctgaggttcagaatctgtatcgttggctagaggttgactttcatccc
ttgaagttatcccagagagtggccagctctatggagtacatcgagaacaatgaggacttg
tgtcagtatgagtctgctctgcatgaaatcaccatcacaagacttctgaagcagatttca
caagtgtaccaaactattgagtttgcccgcctggctaaactggctccttttgctaacaag
tttcagctagagcgtgtcattgtggactctgctagaagactagagttgcagatacggatt
gaccatcgcaccaagtctttaagctttggaatggacttgggagtggcacagaaagaagat
gtgccggagggtccatatctgcagagcatgcccagtgagcagattcgcaaccagatgacc
aacatggctcaggccttgcataaggctgtcaacatgatcaagccagaaggcaaaaagaag
aaggaagaagaaatcaaggagcatatagtgacagcctatcgccagacatcagcccgtgag
catcagcgtatcttgtctcgaagacagatcattgaggacaggaaagaactgctggagagt
ctcagtgtccagagggaaagggaagagttgcaaaaggaagaagagatccgcagtaaggcc
catgctgctgagatggcacgactggagagagaggcagaggagcgtgaacgccagcgccgc
gtggaagagcaaaaagagatacagaagaagcatgctaaggagaggctgaaacaactgaaa
gagactgaattgggagcaaaggctttcaaagatctgcatgaagaggatattgttgagctg
gatgcagatgagatcctggccagacaggtggagcagttggagaaggagaagaaggaactg
caagaaaggctaaatgctcagtctaagaaggttgatcatcttgctagagccaaatgtctg
gaagagattccactattgaagcagcaatatgaagaggagaaagttaagctcagagagttt
tgggagcaggaggaacaagaaagaattgaaaagatcatggctgaacgtgaaatggctctg
gagcacagtgatcgtctgaagagaatgatggaagacaaggatgctttcctgaagaaaatt
gcccaggctagaatgtctgtctacaaggaaaaacttgctgagtttaataagaaattggca
gaagagcgcaagaaacgcctgcagaagagaaaggaaatgcgcatcaaggaacgtcgccag
aaacgtcaagaagaaaaagaagaggctgagcaaagagctagagaagaggcaatgaagaga
gagcgagaagaaaaggagagaattgaaagggagcagagagaggaggaggagaggcagtat
gaggagaagatgagaaagctggaagagatagcagaaaagcaaaggcagaaggaaagagag
atagaggaaagagaagctaagaggagagaagaaataagggggcaagatgatcgtggaggt
gaccagagagaggaacgtggaggtgcatggagagcacctgtcagaggaggtggctggaga
gagagagaaaaagaaagagaattgagctggaaaaaaagggatgatggtgatggtgggcgt
gaacatgactggcgtagaggtgaaggtcctaggattgagcgcgatttcaggagagatgag
ccaagggatttgcgcaaagatgaacgtggacctgatagagatttccgacgtgatgacaga
ggccctccagatagagatatgcgcagagacgaccgaggccctgacagagatttctgcaga
gatgcttcaccaaggggtggttttggccgtggtggagatgatggaagaccaccagcacga
gatgacagagattggggtcgccgtggtgatgacagagattggggaagaagagagcctcct
cgtgatgattggaggagaggcccacctgccagagatgagagagacagcaggatgccttat
agagatatcagggaagaacatcgagacagcagaatgcctgctagagacatcagagaggag
agagatgggagaatgccagccagagacataagagaagaccgtgacagcagaatgccagct
agagatatcagagaggatagagattttggcaggcgtgatggcccaccaagagatgactgg
cgcagaggtccaccaagagatgatcgcgatggtggaggatggcgtcgtggcggagatgaa
agaggaccaccatccagagatgactggggtggccgtggaggaggcagagatatgagaggt
gctggcagaaatgaagagagggaatggagaagaggtgatacaaaagatgccccaagcagg
gataagagaggggatggcgatgaatggacgacagtcaagtactga

DBGET integrated database retrieval system