KEGG   Lingula anatina: 106153540Help
Entry
106153540         CDS       T04921                                 

Definition
(RefSeq) glutathione synthetase
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
lak  Lingula anatina
Pathway
lak00270  Cysteine and methionine metabolism
lak00480  Glutathione metabolism
lak01100  Metabolic pathways
Module
lak_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106153540
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106153540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lak04147]
    106153540
Enzymes [BR:lak01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     106153540
Exosome [BR:lak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106153540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 106153540
NCBI-ProteinID: XP_013382969
UniProt: A0A1S3HCX1
Position
Unknown
AA seq 536 aa AA seqDB search
WDGSLGKWTYNGMKNMPHDIDSDSDENASDDDDERCPRRSKRLASLTRRLDRRMEPCMPL
PVKEDELQELVSMAKDWALTHGNTMRTADRPTSSEVTNYAPFLLLPSPFPERLFHQACAV
QQDFNLLYHRVAHDHDFLQSTLQSAIKVDDFTKRLWDIYETVRKEGIKQPVSLAINRNDF
MTDSQGRTLSTPEDVNTLGIKEVEFNTIASSFAGLETQVGLFHRFILERCGLADKVNKLP
ANTCVPGIAGGMVQAWELYGNTEAVILFLTETVSRNIFDQRWLEWGIYEINSKVKVLRRS
FDQVYRKSQLTEDNKLILEGHEVAVVYFRCGYSPNDYITEEDWTTRLRIERSTAIKCPNI
YYHLAGAKKVQQELGRPGVVERFIQDSEAVKRIRATFAGMYSLERDAEGDAAVAMAMENP
FKYVLKPQREGGGNNYFGEDVRKVLERVLDSDERMAYILMERIHPVPFQNYVLRAESPVQ
PNTMLSELGVYGVLIGTSDRIITNKQCGHLLRTKTSDTNEGGVATGYSAIDSPYLV
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
tgggacggctctttgggcaagtggacatataatggtatgaagaatatgccacatgacatt
gattcagatagtgatgagaatgcgagtgatgatgatgatgaacgctgtcccagaaggagc
aaaagactagcatccttgacacgtagacttgaccgaaggatggagccatgtatgccactg
cctgtgaaagaggacgagttgcaggagctggtttccatggcaaaagactgggccctcact
cacggaaacactatgcgcactgcagacagaccaacgtcatcagaagtaactaattatgcc
ccttttctgcttctgccttcaccattcccagagcgactttttcaccaagcatgcgcagtg
cagcaagactttaatcttctctatcaccgagtagcacacgaccatgactttctgcagtca
actctccagagtgcaattaaagtggatgatttcaccaagagattgtgggacatttatgag
acagtgagaaaggagggaattaaacagcctgtgagtcttgctatcaacagaaatgatttt
atgactgactctcagggtcgcaccctctccaccccggaagatgtgaacaccctggggatc
aaagaggttgagtttaacactatagcttcaagttttgctggtctagaaactcaagtgggg
cttttccacaggtttatacttgaaagatgtggtctggcagacaaggtcaacaagctacct
gctaatacatgtgtgccaggaatagctggtggtatggtccaggcttgggaactgtatggc
aacacagaagcggtgatattgtttttgacggagactgtttcgagaaacatatttgaccag
cgctggctggagtggggaatatatgaaatcaacagcaaggtgaaggtcctcagaaggagt
ttcgatcaagtttacagaaagtcgcagctcactgaggataacaaattaatccttgaaggt
catgaagttgctgtagtctacttcagatgtggatactccccgaatgactacatcacagag
gaggactggacaaccaggctaaggatagaaaggtccactgccatcaagtgtcccaacatc
tactatcatctggcaggtgctaaaaaggtacaacaagagcttggcaggccgggagtggtg
gaacggtttatacaggactctgaggctgtgaagagaattagagcaacttttgctggcatg
tactccctggaaagggatgctgagggtgatgccgctgttgccatggcaatggagaatcca
ttcaaatatgttctcaaacctcaaagggaaggtggaggaaataactacttcggagaagat
gtcagaaaggtgttggagcgtgtgctagacagtgatgaaagaatggcatacattctgatg
gagaggatccatcctgtgcctttccagaactacgtactgcgtgctgaatctcctgtacaa
cccaataccatgctcagtgaattgggtgtatatggggtgcttattgggacctctgaccgt
atcatcactaacaaacagtgcgggcatttactgagaaccaaaacctcggacaccaatgaa
gggggcgtggcaacaggctactctgctatagacagcccgtatttagtatga

DBGET integrated database retrieval system