KEGG   Lingula anatina: 106153933Help
Entry
106153933         CDS       T04921                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
lak  Lingula anatina
Pathway
lak00010  Glycolysis / Gluconeogenesis
lak00562  Inositol phosphate metabolism
lak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106153933
   00562 Inositol phosphate metabolism
    106153933
Enzymes [BR:lak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     106153933
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     106153933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Inhibitor_I68 DUF2721
Motif
Other DBs
NCBI-GeneID: 106153933
NCBI-ProteinID: XP_013383537
UniProt: A0A1S3HBY2
Position
Unknown
AA seq 503 aa AA seqDB search
MSGHRRLTTCLLVLVLGLVCFCHCVGAGQIPCYTSDPNPYRRYSTKSAYAEIPAVTGGTD
TGRSDTVDADCYPVMIWHLLRHGYRYPADSDIELFNALLPVFRDNIVANTTVSNQFCAGD
LAALRDWKPRMDPSDGSKLVMTGYEEMMRIAKNFRIKYPTLLNVSIDDMLASFHFRHTDT
ERTRESAKSFAKGLLKQPGMTDQELEALVNRIPMTVYPTTNDRLLRFFDACERYKKTIRS
KPVAELDKFDNGSIMSEVIANISRRIGLRQNMNISVSQSLWLACASEYAIYGLTQDSTVK
NSSAAPWCSVFSQDDLKAFEYRTDLAYYYKNSYGHKLSYEQACPLLKDFIGSIRNATTKD
NFTKVVIRVGHSPTIVPFYANLGLFKDSRPLTADNFLSQGNRKLRTSYIDPMASNINFVI
YKCGNAHKFKMHVNERETTFPGCNGVFCDIETLMGSVGKAADTCDFDQMCKWPIHPSTGG
ATRADGAMTFWLMIFSKFLMPVV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtccggacacaggagacttacaacctgtttgctcgtgcttgttttaggcctggtatgc
ttttgtcattgtgtgggcgccggtcagataccgtgctacacgtcggaccccaatccctat
cgacggtacagcaccaaatcagcatacgccgagataccagcggtgacagggggaacggac
acggggagaagtgacaccgtggacgcagactgctaccctgtaatgatctggcatctgctt
cgccatggataccgttaccctgcagacagcgatatagaactctttaatgccttactgcca
gtatttcgggacaacattgttgccaatactacagtatctaaccagttctgtgccggagat
ctcgcggcgctgcgagactggaaaccgagaatggatccaagcgatggttctaaattggtc
atgaccggctatgaagaaatgatgcgtattgctaaaaacttccggattaagtacccaact
ttgctgaacgtttcaatcgacgacatgcttgcatccttccacttccgacatacagacact
gagcggacccgagagagtgccaagtcgtttgcaaagggattgttaaagcaaccaggtatg
accgaccaagaactggaggcgcttgtcaacagaataccgatgaccgtgtatccaacgaca
aatgaccgtctgcttcgattctttgatgcctgcgagagatacaaaaagaccataaggagc
aagcctgttgcggaactagacaaatttgacaacggctcaataatgtcggaagttattgct
aacatatcaaggaggattggactgagacaaaacatgaacatttccgtgtcgcagtccttg
tggctcgcttgcgccagtgaatatgccatatatggcttgactcaagacagtaccgtcaaa
aattccagtgctgctccctggtgttcggtttttagtcaagacgacctgaaggcatttgaa
tacagaaccgacctagcttattattataaaaactcttacggacataagctcagctatgaa
caggcctgccctcttttgaaagatttcatcggatcaattaggaatgcgacaacgaaagac
aattttaccaaagttgttattcgagttgggcattcgccgacaattgtgccattctacgca
aatttagggctcttcaaggattcaagaccattgacagctgacaacttcctctcccaaggg
aacagaaaactcagaacaagttacatagacccaatggcatccaacataaactttgtcatc
tacaaatgtggaaacgcccacaaatttaaaatgcatgtgaacgaacgcgagaccacgttc
cccggatgcaatggcgtgttttgtgacatcgaaacactgatgggctctgtagggaaagcc
gcagacacgtgcgattttgatcagatgtgtaaatggcctattcacccatcaacaggagga
gccacaagagctgatggtgccatgacgttctggctgatgattttttccaagtttcttatg
cctgtcgtataa

DBGET integrated database retrieval system