KEGG   Lingula anatina: 106154483Help
Entry
106154483         CDS       T04921                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lak  Lingula anatina
Pathway
lak00450  Selenocompound metabolism
lak00970  Aminoacyl-tRNA biosynthesis
lak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    106154483
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106154483
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lak01007]
    106154483
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lak03016]
    106154483
Enzymes [BR:lak01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     106154483
Amino acid related enzymes [BR:lak01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   106154483
Transfer RNA biogenesis [BR:lak03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    106154483
 Prokaryotic type
   Other AARSs
    106154483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS GST_N_5 tRNA-synt_1 Anticodon_1 GST_C GST_C_2 tRNA-synt_1e C1_1
Motif
Other DBs
NCBI-GeneID: 106154483
NCBI-ProteinID: XP_013384289
UniProt: A0A1S3HGY8
Position
Unknown
AA seq 982 aa AA seqDB search
MKLISDAGNIHTLKIAIASELTGTHLQYEEVKHDEKVAGALTQNKLPILEVDTGLTLFSA
NAACRYILCKAGQDVDSLMVDQWLEWEAAELQPVLWPYLVSSVGQGKVESKQVQAVKGLL
AHLDDALHLKELIVRDQISAADIVLWSALFPAFFDIAALQDWSSQYLNISRWFNKLSQHP
AFQKGFTMVTSGKGVSAFKASLLAQPVPLPAIWDTKKLKMTLTGSGDKEKTEPPSEEKSV
SVTAEETKAAVAAWKQMTTPTPVQRTHPILPQEGKRNILITSALPYVNNVPHLGNIIGCV
LSADVYARFCRLRNYNILYISGTDEYGTATETKALEEGLTPQQICDKYNKLHSEIYEWFN
IDFDYFGRTSTTQQTEISQDIFWKLYEKGFVITDTVEQLHCAKCDRFLADRFVEGTCPLC
AYEDARGDQCDKCGKLINATELKNPKCKVCKTTPEIKTSEHLFLDLPKLEPTLSSYLDKQ
FEDGIWTQNAKVITKSWIRDGLKPRCITRDLKWGTPVPLEGFTDKVFYVWFDAPIGYISI
MANYTDKWKQWWKNPQQVQLYNFMAKDNVPFHSVIFPCTLLGADDNFTIVNHLSACEYLN
YEDGKFSKSRGIGVFGNNAQETGVPADIWRFYLLFIRPESQDSTFAWEDFVLKNNSELLN
NLGNFINRALMFVANSFGGQVQEITLTSEDEELLALITRDLKAYVDCLEKIKLREGITHI
LNISRLGNQYMQANKPWELVKGDAAQKSRAGTVVSLSANIACLLSVLLQPYMPQVSATIQ
MQVNAPKECNVITEKFVCLLKPGHKIGTPQPLFKKMDPKEAEAHKKKFAGQGDDSKKATS
GGKGKGPAAAVAANPAEAERLTAEVAKQGDAVRQLKASKADKTTIDAAVAVLLDLKKQLS
AAQGQNSHGHSNTADPAAAERLTAEVTKQGDVVRQLKASKADKSSIDEAVAVLLDLKKQL
ALAQGQNPTDVQGSGKKKGKKK
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttataagtgatgcagggaatatccacacgctgaaaatagcgatcgcttcggaa
ttgactgggacccatctgcagtatgaggaagtgaaacacgatgagaaagtggcaggagct
ctgacccagaataagctgccaatactggaggtagatacgggattgacattgttctcagct
aatgcagcatgcagatatatactgtgcaaggctggtcaagatgtggacagcctgatggtt
gaccagtggctggagtgggaggctgcagaattacagcctgtactttggccgtacttggta
agctcagtgggccaaggcaaggtggagtctaagcaggtccaggctgtgaaagggctctta
gctcatctggatgatgcactgcatttaaaggaactaatagtgagggaccaaatcagtgct
gcagacattgtcttatggtctgcactctttccagctttctttgacattgcagctctccag
gattggtcttcccagtacctgaatatctcccggtggttcaacaagttatctcagcaccca
gcctttcagaaggggttcaccatggtcaccagtggaaaaggggtctccgccttcaaagca
tccctgctagctcaacctgtaccactacctgcgatatgggacaccaagaaactgaagatg
acgttgacaggctctggagacaaggagaagacagagcctccaagtgaggagaagtcagta
tctgtcacagcagaggagacaaaagctgcagtggcagcatggaaacaaatgacaacgccc
actccagtgcaaagaacacatccaatattacctcaggaaggcaaacgtaatatccttatc
acgagtgcactgccgtatgtgaacaatgtcccccatcttggaaacatcattggctgtgtg
ctgagtgcagatgtctatgccagattctgtcgtttgagaaactacaacatcttatatatc
tctggcactgatgaatatggaacagccactgaaactaaggctctggaggaagggctaact
ccacagcagatatgtgacaaatacaacaaacttcactccgagatctatgaatggttcaat
atagactttgattattttgggaggacatccactacccagcagacagaaatttctcaggac
atcttctggaagctgtacgagaagggttttgtgataactgatactgtagagcagctccat
tgtgctaaatgtgatagatttttagcagacaggttcgttgagggcacgtgcccattgtgt
gcgtacgaggatgcacgtggggaccagtgtgacaaatgtggtaagctcattaatgccact
gaactcaagaatccaaagtgtaaagtatgcaagaccaccccagagatcaagacatcagag
catctgtttttagacttacctaagcttgaaccaacactgtccagttatctagacaagcag
tttgaggacggtatctggacacagaatgccaaagtaattaccaagtcctggatacgtgat
ggtctaaagccacgctgtatcacacgggacctcaaatggggaacaccagttccactggaa
ggtttcacagataaggtgttttatgtatggtttgatgcccctataggctatatatccatc
atggctaactacactgacaagtggaaacaatggtggaaaaatccacaacaggtccagttg
tataatttcatggccaaggacaatgtccccttccacagtgtaatcttcccctgcacttta
ctaggtgctgacgacaacttcacaatagtcaaccatctaagtgcttgtgaatacctgaat
tatgaagatggcaaattttctaagagtcgtggtattggtgtatttggcaataatgcccag
gagacaggtgtgcctgcagatatctggaggttttacctgctgtttataagaccagagtca
caggacagcactttcgcttgggaggattttgttttgaagaacaacagcgaattgctcaat
aatttagggaatttcattaacagagctctgatgtttgtagccaactcattcggaggccag
gttcaggaaataaccctaacatctgaagatgaagaattactggcgttaatcacacgggat
ctcaaagcctatgtggactgcttggagaaaattaaactgcgtgaaggcatcacccatatc
ttaaatatctccagactggggaaccagtacatgcaggccaacaaaccatgggaactagtc
aagggagacgcagcacagaagtctagagcaggaacagttgtcagtctgtcagccaacata
gcatgcctgctgtcagtactgctgcagccctatatgcctcaggttagtgccaccatacag
atgcaagtgaatgcccccaaggagtgcaacgtcattacggagaaatttgtgtgcctcctc
aaacccggacacaagattggaactccacaacctctgttcaaaaagatggaccccaaggaa
gctgaggcacacaagaaaaagtttgcagggcaaggagatgactctaaaaaggctacttct
ggtggtaagggtaaaggtccagcagcagctgtagcagctaatcctgctgaggcagagcga
ctgacagcagaggtagcaaagcagggtgatgctgttcgtcagttgaaggccagcaaggca
gacaagaccaccatagatgctgcagttgctgtgttgctggatttgaaaaaacagttgtct
gcagctcaggggcagaattcccatggtcatagtaatactgctgacccggcggcggcagag
aggctgacagcagaggtgacaaaacagggtgacgttgtccgtcaactgaaggccagcaag
gcagacaaatcctccattgatgaagcagtagcagtattgctggatttgaaaaagcaatta
gcgctagcacaggggcaaaacccaacggatgtgcaaggaagtggcaagaaaaagggcaag
aagaagtga

DBGET integrated database retrieval system