KEGG   Lingula anatina: 106155714Help
Entry
106155714         CDS       T04921                                 

Definition
(RefSeq) galactocerebrosidase isoform X1
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
lak  Lingula anatina
Pathway
lak00600  Sphingolipid metabolism
lak01100  Metabolic pathways
lak04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    106155714
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106155714
Enzymes [BR:lak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     106155714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Glyco_hydro_30
Motif
Other DBs
NCBI-GeneID: 106155714
NCBI-ProteinID: XP_013386134
UniProt: A0A1S3HM75
Position
Unknown
AA seq 716 aa AA seqDB search
MEMGHAYNFFVLLAFPGLILSRAQCALQKVNVDDSYGVGRNFDGIGAISGGGPRNCWAVD
GGMPNDHQKITVDDSYELGRYFDGIGGLSAGATSKLLVNYPEAQRNQVLDFLFKPNFGAS
LQILKVEIGGDSQSTDGVESSHMHTEEDVSFQRGYEWWMMKEAKKRNPNIKLYGLPWVFP
GWLGNGTFNPYAMREKLVYYITSWIKGAAKVHNLQIDYIGIWNERSYDIDYIKMLRMSLD
NQGFSHTQIVAADGGWGIASDVLKDPDLANAVCILGAHYPGSMATADAQKTGKKLWASEE
YSAFNNLAGGGCWARVLNEGYVNGNLTSAIAWNLISSYSAALPYSGSGLMTANQPWSGYY
VVNTPIWMSAHYTQFTEIGWSYLDHGHGSGHLDSNGSYIALTSPDRSQLTIVIENMDPHD
APCFYPMPKYTVAPQTVTFTLKGSFSKIQELEVWFSFFNFTQGGHSDIFIYQGPLKIVNG
SFSLTVMPNVVITLTTVKSGRKGQYPTPPPPAPFPLPYKDTFQDYAEFSEPYNLAPQAGS
FEIRSSSEPGIPKVLRQVVPQPPIDTCLPKRMPRPIAVIGNHSWADVRVEIMCRVPASNG
SSGLFIASRVSSGGCSAMYSNGLYFWLLLEERKFLLSSDYAQKVVYANGTLPNSIDFNTW
TSMSLFAQGKKVRGMLNSKDVFNLELKTVVSAYGFVAIGTNDFGMADFINMFIDKT
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggggcatgcatataatttctttgttttattggctttcccagggcttattcta
agtagagcacaatgtgctcttcaaaaagtcaacgtagacgactcgtatggagtgggaaga
aattttgatggtatcggggcaataagtggaggaggacctcggaattgttgggcagttgat
ggtggaatgccaaatgaccaccagaaaattactgtagatgattcatatgaacttgggagg
tattttgatgggattgggggattaagtgcaggtgctacatcaaagcttttggttaattat
ccagaggctcagagaaaccaggtgctagattttttatttaagcccaattttggcgcttcc
cttcaaatattaaaagtagaaattggaggtgattcacaaagtacagatggtgtggagtca
tctcacatgcacacagaagaagatgtcagcttccagagaggatatgaatggtggatgatg
aaggaggctaagaagagaaatcccaacataaagctatatggtcttccctgggtgttccct
ggctggttaggaaatggaacattcaatccatatgctatgagagagaaacttgtgtactat
ataacttcctggatcaagggagcagcaaaagtgcacaatttgcagattgattatattggg
atttggaatgaaagaagctatgatatagactacatcaagatgctacgaatgtctctggac
aatcaaggatttagtcatactcagattgtggctgctgatggtggttggggaatagcgtct
gatgtcttgaaagatcctgatttggcaaacgcagtctgtattttgggagctcactatcct
ggtagtatggctacggcagatgctcaaaagactgggaaaaaactgtgggcttcagaggaa
tacagtgccttcaataacctggctggtggaggctgctgggccagggtcctaaatgaaggc
tatgtgaatggaaatctaaccagtgccattgcatggaacctgatctccagttacagtgct
gctttgccctacagtggatctggtctgatgacagccaaccagccctggtcaggatattat
gtagtcaatactcctatttggatgagtgctcattacactcagttcacagaaattggctgg
agctatcttgaccatggtcatggctctggtcatctggacagcaatggcagttatattgca
ctgaccagtccagacaggtctcagctgaccattgtgatagagaatatggatccccatgat
gccccatgtttttatcctatgcctaagtacacagtggcaccacaaactgttactttcaca
ctgaaaggctcattttctaaaatacaggagttggaagtctggttttcatttttcaacttt
actcagggaggacacagtgacatttttatttatcagggaccattgaagattgtgaatggc
agtttcagcttaactgtcatgccaaatgttgtgatcacattaaccacagtgaagagtgga
aggaagggacagtaccccactcctcccccacctgctccttttcctttgccatataaagat
acattccaagactatgcagaattcagtgagccttataatctagcaccacaagctggctcc
tttgagatcaggtcttcctctgaacctggaattcctaaggtgctacgtcaggtggtacct
cagcctcctatagacacctgtttgcccaagagaatgcccaggcccattgctgtgatagga
aaccactcttgggcagatgtcagagtagaaatcatgtgtagagtgccagcaagtaatggt
agctcagggttatttatagcaagccgtgtcagcagtgggggatgcagtgccatgtactct
aatggcctgtacttctggttgctactggaggaaaggaaatttttgctttcttcagattat
gcccaaaaagttgtttatgcaaacggaactcttccaaatagcattgattttaatacttgg
acatctatgtctctttttgcccagggaaagaaggtgaggggcatgttaaacagcaaagat
gtgttcaaccttgagctaaagactgttgtctcagcctacgggtttgttgccataggaacc
aatgattttggaatggctgattttatcaacatgttcattgacaaaacatga

DBGET integrated database retrieval system