KEGG   Lingula anatina: 106155796Help
Entry
106155796         CDS       T04921                                 

Definition
(RefSeq) probable protein S-acyltransferase 23
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
lak  Lingula anatina
Brite
KEGG Orthology (KO) [BR:lak00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lak04131]
    106155796
Enzymes [BR:lak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     106155796
Membrane trafficking [BR:lak04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    106155796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 106155796
NCBI-ProteinID: XP_013386257
UniProt: A0A1S3HJR2
Position
Unknown
AA seq 205 aa AA seqDB search
MWISLYHANSIDPGFLPRNIPEYDMAIKQVAHFAEWKHGKNPLSRLCHTCRTVKPLRSKH
CRICQRCVSEFDHHCPYIYNCVGYNNRVWFTMFVCLVFVNCVITLYFCYWILEANGWDDY
ITIIGGLEATLFTFLAAVLSSVSLFHATKNITTNERINHKRYDYMKDGKGNFYNPFDRGV
WHNIKEFLHLRKPLGEEEVQLLNVV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtggatctccctgtaccatgctaactctatagacccgggcttcttacccaggaacatt
ccagagtatgacatggccattaaacaggtggctcactttgctgagtggaagcatggaaag
aaccctctaagtcgtctatgtcacacatgtcgtacagttaaaccacttcgctccaaacac
tgtaggatatgtcagcgttgtgtgagtgagtttgaccaccattgtccatacatctacaac
tgtgtgggctataataacagggtttggtttaccatgtttgtctgcctggtgtttgtgaac
tgtgttatcaccctgtatttctgttactggatactggaagccaatgggtgggatgattac
attaccattattgggggtctggaggccactctgttcacttttctggcagctgtcctcagc
agtgtctcgctatttcacgctacaaagaacattaccacaaatgagcgaattaatcacaag
agatacgactacatgaaggatggaaagggaaatttctacaatccctttgatcgtggtgta
tggcataatattaaggagttcttacacctgagaaaaccactgggggaggaggaagtccag
ttacttaatgtggtgtga

DBGET integrated database retrieval system