KEGG   Lingula anatina: 106157534Help
Entry
106157534         CDS       T04921                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
lak  Lingula anatina
Brite
Enzymes [BR:lak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106157534
Peptidases [BR:lak01002]
 Serine Peptidases
  Family S33
   106157534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Esterase Abhydrolase_5 Abhydrolase_3 DUF2048
Motif
Other DBs
NCBI-GeneID: 106157534
NCBI-ProteinID: XP_013388668
UniProt: A0A1S3HRL0
Position
Unknown
AA seq 325 aa AA seqDB search
MAKVVALTSLTAVVLTAAGRLLYRRWFHTPANYVRELNRQYYKEAGVEAKRQQVGPHNFA
YLEKGTPTTERPSLLFVHGFTGEKENWLFVLKRLPAERHAIAVDLLGHGDSTDYPDDPSI
RNQAQTVKKFVDTVGLQKPFLIIGQSMGGAIVGNYAAMYPEDVATVTLLCPLMKTPTPST
MIADAKAGRTTALQDAFSPEAVQYMLDQCSVEKREYPRVLLEGIAELRRRHEAFFGKLYF
ALGKHENRTALETSLPKITVPVHVLWGDQDQIVHVSGTEVIEKVSPRSKITIIKNKGHSL
NVECPQIVVDSVLDSTRGTTPKSSL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagtggtagcactgacatctctcactgccgttgttctcacggctgctggaaga
ctcctctacagacgatggtttcatacgccggcaaattacgttagggagttaaacagacaa
tattataaggaagccggggtcgaagcgaagagacaacaagtcggaccacacaatttcgct
tacctggagaaggggacaccgaccacagaacgaccgtcactcctgtttgtccacggcttt
acaggagagaaggagaactggctgtttgttttaaagcgtctcccggccgaacggcacgcc
attgctgtagacctactgggtcatggcgacagtacagattatccagatgatcccagcatt
cgaaatcaagcacagacggtcaaaaagtttgtggacacggtgggtctgcagaagccattc
cttatcattggtcaatccatgggcggagctattgttgggaactacgccgccatgtacccg
gaagatgtcgccactgtcaccttactgtgtccattgatgaagacgccgactcccagcacc
atgattgcggacgccaaggctgggaggaccacggccttacaagacgccttcagtcccgag
gccgtccagtatatgcttgaccagtgttccgtggaaaaacgagaatatccacgcgttctc
ttggaaggcatagcagagttgagaaggcggcatgaagcttttttcggcaaattgtatttt
gcgctggggaagcatgagaaccggacagcactggagacctctcttcccaagataacggtc
cccgttcatgtcctttggggtgaccaagaccagatcgttcacgtctcaggtacggaagtc
atagaaaaggtgtctcccaggagcaagataacgataataaagaacaagggtcactcttta
aacgttgaatgtccgcaaattgtggtggacagcgttctggactctacacgtggcacaaca
cccaagtcttccctataa

DBGET integrated database retrieval system