KEGG   Lingula anatina: 106160561Help
Entry
106160561         CDS       T04921                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
lak  Lingula anatina
Pathway
lak00020  Citrate cycle (TCA cycle)
lak00640  Propanoate metabolism
lak01100  Metabolic pathways
lak01200  Carbon metabolism
Module
lak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lak_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106160561
   00640 Propanoate metabolism
    106160561
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lak04147]
    106160561
Enzymes [BR:lak01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     106160561
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     106160561
Exosome [BR:lak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106160561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 106160561
NCBI-ProteinID: XP_013392654
UniProt: A0A1S3I5K9
Position
Unknown
AA seq 430 aa AA seqDB search
MASILARGGTFLRGTAIRQCQKILGVTPSLDGHQQSRHLSIHEHQSMTFLLNQGISVPKF
KVAKNGEEVYAIAKELGETTDSTDVVVKAQVLAGGRGKGVFDSGLKGGVKIVFSAEEARD
LACKMINHNIVTKQTGEAGRPCKEVMVCERLYSRRECYLAITTDRAYGGPVIVASAEGGI
DIEEYAREHPQGIIKEPIDITTGIRKEQALSVAEQLGFSEGRKDEAADYIMKLYHMFLDL
DASLIEINPLAEDIKGKVYCMDCKINFDDNAKFRQQELFGLQDWSQEDERDYKAHLADLT
YIGLDGDIGCLVNGAGLAMATMDIIKVHGGAPANFLDIGGGASVEQVTEAFKLITSDPKV
RAILVNIFGGIMRCDIIAQGIIEAAQTLQLKVPIVVRLQGTRVDDAKMLIANSPLRILAD
DDLDSAAKMG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctatcttggcaagaggtgggacatttttgcgtgggacagctattcgacaatgt
caaaagatattgggagtaacccccagcttggatggccaccagcagtcaaggcacctttcc
atccatgaacaccagagcatgactttcctgctaaatcaaggaatcagtgtcccaaagttt
aaagtagcaaaaaatggcgaagaagtatatgcaatagctaaagagctaggagagaccaca
gacagcacagacgtggtggtcaaggcccaggtgctggccggtggacgaggcaagggagtc
tttgacagtggactcaagggaggggtcaagattgttttctcagctgaggaggctagagac
ctagcctgcaagatgataaaccacaacatagtcactaaacagacaggagaggcaggtcgg
ccctgtaaggaagtcatggtttgtgagaggttatattctaggagagaatgctacctggcc
atcacaacagacagagcttatgggggaccagtgatagtagccagtgctgagggcggtata
gatatagaagaatatgccagggaacatccacagggaattattaaagaacctattgacatc
actactggaatccggaaagaacaggctctctctgtagcagaacagctaggattttcagaa
ggaaggaaagacgaggcagcagattatataatgaaattgtaccacatgtttttggaccta
gatgcctctcttatagaaattaaccctttagctgaagatataaaaggcaaagtctactgt
atggactgcaagatcaactttgacgacaatgccaaatttagacaacaagagctttttgga
ctgcaggattggtctcaggaggacgagagagattacaaagctcatctggctgatctcact
tacattggcctggacggggatattggttgcctggtaaatggtgctggactagccatggct
actatggacattattaaggtgcacggtggggctcctgccaactttttagacataggaggc
ggtgcatctgtggaacaagtgacggaggccttcaaactcatcacatctgatcctaaggtg
cgagctatcctggtgaatatatttggtggaataatgaggtgtgatatcatagcccagggc
atcatagaagctgctcaaactctgcagctgaaagtgcctattgttgtaaggctacaaggc
acaagagtggatgatgccaagatgttgatcgctaatagtccactaagaatactcgctgat
gatgacttagacagtgctgccaagatgggatag

DBGET integrated database retrieval system