KEGG   Lingula anatina: 106161038Help
Entry
106161038         CDS       T04921                                 

Definition
(RefSeq) methyltransferase-like protein 14 homolog
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
lak  Lingula anatina
Brite
KEGG Orthology (KO) [BR:lak00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lak03019]
    106161038
Enzymes [BR:lak01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     106161038
Messenger RNA biogenesis [BR:lak03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     106161038
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 106161038
NCBI-ProteinID: XP_013393324
UniProt: A0A1S3I7H6
Position
Unknown
AA seq 452 aa AA seqDB search
MESSLKHRRERSQKRRQLLAQQLGVTSTKQLSTVLGSKEEYKEESRIESPALPDGNAAGK
SNFPLGKEPESLPVQEQEKEGEEEYEEIYTGSSTFLKGTQSANPHNDYCQHHVDTGERPQ
NFIRDVGLANRFEEYPKLRELIRLKDELIASTATPPMYMNTDLESLYLGDLDCKFDVIYV
EPPLEEYQRTHGVVFDKYWTWQEIESLEIEKISAQRSFIWMWVGSSEGLDAGRRCLRKWG
FRRCEDICWIKTNIKNPGHNKNLEPKAIFQRTKEHCLMGIKGTVRRSTDGDFIHANVDID
LIIDEEPEYGSKEKPVEIFHMMEHFCMGRRRIHVFGRDSTIRPGWLTIGPDVSSSNFDAE
LYNSYFNKEPNGHLTGCSEEIDRLRPKSPTPKAKAGGGQAPPRGGMVRGGMSRGGGPSRG
RGEPGWRGRGGTTRGGFVPRGRGGPRPGPPPR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggagagctccttgaaacaccggcgcgaacgttcgcagaaaaggcgacagcttctcgcc
caacagctgggagttacaagcaccaaacagctaagcacagttctaggcagcaaggaagag
tacaaagaagaaagtagaatagaaagtcctgcactcccagatggcaatgcagcagggaaa
tccaactttcctttaggaaaagaaccagagagtttgccagttcaagaacaggagaaagag
ggagaagaagaatatgaagaaatttatacaggttccagcacttttctgaaggggactcag
agtgctaaccctcacaatgattactgtcagcatcatgtggacacaggggagagaccacaa
aactttatcagagatgtgggtctagcgaatcggtttgaagagtacccaaagctgagggag
ctgatacgactgaaggatgagctcattgcgtccactgccacacctcccatgtatatgaac
acagacctggagtcactctaccttggtgacttggactgtaagtttgatgtgatctacgtg
gaacccccactggaggagtaccagagaacacacggcgtagtctttgacaagtactggacg
tggcaggagattgagagtctagagatagagaagatatcagcacagaggtcgttcatctgg
atgtgggtgggatccagtgaaggattagatgcaggaagaaggtgtctcagaaagtggggt
ttccgtcgctgcgaggacatctgctggattaagaccaacattaaaaatcctggacacaac
aagaatttggaaccaaaagcaatatttcaaagaacaaaggagcactgcctgatgggaatc
aaaggtacagttcgccgcagcactgatggagacttcatccacgccaatgtggacattgac
ctaatcattgatgaggaacccgagtatggcagcaaggagaaacctgtggagatcttccac
atgatggaacacttctgtatggggagacggcgtatccacgtctttggcagagacagcact
atacgtccaggctggcttaccataggcccagatgtctccagcagtaactttgatgcagaa
ctttacaacagttatttcaacaaagagcccaatggccacttgactggctgttcagaggag
atagacagactgaggcccaagtctcccacacctaaagcaaaggctgggggtggtcaggcc
ccacccaggggaggcatggtgagaggggggatgtccaggggtggggggccttcaaggggt
agaggtgagccaggatggagggggagaggggggaccaccaggggagggtttgtccccagg
gggcgtggaggtcccagaccaggacctccaccaagatga

DBGET integrated database retrieval system