KEGG   Lingula anatina: 106161264Help
Entry
106161264         CDS       T04921                                 

Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
lak  Lingula anatina
Brite
KEGG Orthology (KO) [BR:lak00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lak01001]
    106161264
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lak04131]
    106161264
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lak04812]
    106161264
   04147 Exosome [BR:lak04147]
    106161264
Enzymes [BR:lak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106161264
Protein kinases [BR:lak01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   106161264
Membrane trafficking [BR:lak04131]
 Others
  Actin-binding proteins
   Others
    106161264
Cytoskeleton proteins [BR:lak04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     106161264
Exosome [BR:lak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106161264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set C2-set_2 Ig_4 C1-set SH3_1 SH3_2 SH3_9 IQ SH3_3
Motif
Other DBs
NCBI-GeneID: 106161264
NCBI-ProteinID: XP_023930290
UniProt: A0A2R2MJA5
Position
Unknown
AA seq 9807 aa AA seqDB search
MLRDTRVIEHHPATFDCQVLGHPTPTVFWRKNGKKLEENIRWKFIYPEHEHGSHTFLIYE
TMPEDQGTYECIAENPTGKATSVAKLTVETAKVPATPETPAPEQKVPQVAPKVDLKMVDL
TVKEGEVATFKCKITGSPTPVITWYLDNQVIKPSKYFKMETVGPVHTLTVTEAFPEDEGQ
YRCTAVNPSGEASTTAYLNIIMPVTEEEKPPAEEVEGPRFIKPIASVDIMEGNPVTFEAQ
IEGKPAPEVTWFREGVAIKPSADFQILKEGNRAVLIIKEAFPEDSGIITIQIKNSVGVAE
CSAQLYVEEEVSSHEKEVTDATYVLQMPDIDQEERELTEKIISEEELEKDQQREVEVRIG
KISQPIKPAVIKPIVPTITVGRGKTARLDVQVASFPPPKFKWFVNGMEIVPSKKFQVFME
GSVISLIIVNVDEKDLGEYVLRVWNDMGEVVCKTTLNIPASEKEVVITMPPEFKKPPKQE
VKTQPGKVAKIECLVQAYPPPKVTWYKDKDIELQQSSKYQMTTKEHVVINERICILTIND
IQPEDTGDYTVRAENKLGEVTCRTSLVIAPETKDIELVEGVETVTTTTVTEKVTRTMDYT
EEEEDRRMTVTRGPPQFTEPLKPEIRVPVRGIARLECVVQAQPPPIVSWYVNGEELYPGP
HYEILTEDDKAVLLIIDVGPQDTGEYTCRAKSEEGEAISSTTLYVEPERAVEQQPPSKEE
EMIPPEFTKPLEPFVATDGDEVVMRINVTGKPAPSVSWYFNDNCIDDSEDFIIKYNPDTG
DSVLTIVEVFPEDQGEYKCVALNPVGEAVCVAGLQVLDVISTTEEEPMPDVMTMSATSET
IEQAYEAEQAAFTIQIPAMGPEEEEQEMEVEETPEIVIEERREVVTTTTDDTEEAFTVEI
VAEEEAPEEEVPEEKPAVVEVPVSKPEEAPKEAPVEEKPAVRIATEAKAEPTPEVAPSQE
VEMTLQVKQEPVTPSPTPITGEEQLETADVTQVIGAVQQILIDTKGKEDVAIDSTTRTEE
TITQDQVDAPSRVTETITVEKDQQPEAVEMQFVIEEQPQVTEEVTRVETQVTEVREEMIP
PKFTVPIKPQAVKDGDEVTFTCTVIGKPTPKITWYKDHKEFDLNSDMRIAFDEETGVATF
ELLFVTQDDQAIYTVCAENPAGKATVTANLIVLPADAGPITSTTTTVMEKEGIVVMDERG
PQFTKMPEPVQVTEGQDAKFEIQVTGSPVPTVTWYKSGVEIHPSDRVTITVDSGLSVLNI
SKVTPDDSGDYAVKAVNEFGEMTCRTMLIIRKVQEEMHPPKFTKPIKPQVVQDGEDVTFS
AVVTGKPTPEVTWYRDQVVITPNEDISITFNEETGECTLLLREVFPEDSAVYTITATNPA
GKATITANLVVTEKMEETVEVIQVQPEKMDVSETREVTRVVQQEVVDEAGDMQPPRFSKP
IQPQVVNDGDDVTFSCVVTGQPTPEVTWYRDQEKLTPNEDITITYKEETGECTLLMYGIF
PEDAAVYSVTATNPVGKATISANLIVQSPEEGPIIETTTTVIKKETISQISESEGETERH
LTVIEQQSPEFTKTLKQTTEVTEGETAVLKVEIEAEPKPKVTWHVNGLEVMPSKHLQVDV
MEKVSVLKIFNVTPEDAGDYVCKAENELGEMSCTTTLVVNKPKTVELKPAPGDKVPVTEK
PEQATAGKLPASSESSSKSESEQEKFPEKEGERSPTEPVEMPVEEQVPEEQPVVIGEAPD
FIKPLCSQNVMDGDSVTFHVKFTGYPAPTITWFHNKKLVEPGPDFRLGTDRERGDSILLI
PEVFPEDKGEYMAIAVNDFGMAETTCRLIIITSESEQSFDSSEEEKSYKVVKDTDVHTQM
TQISQQQLPEELQIRIQSPEQPVPGEEDEEHYQETVEVQEYRDASQEYEIKFEPHKPVTS
TAEVQQVLQPQPQGYKMDIEIQGAPSETSSIVVQPKSEEVSPEVRQTQQVIISLEHPEKK
STEVRREETHTEEVDGTVKHEIRTMVSKESEITTSDVEETEEYWTETLSESEKEVMLQEE
YVVPEEVPEWAVAPQFTWGLMSLKVMDGEEVKFCCEVTGTPSPTITWYKNNKLLKENQDF
KMEYSPESHSCTLMIVEVFPQDSGEYKCVARNIAGQAITSAMLEVESYEYVADTEEASES
LMSSASVGSASPVRLASTDQVTLLSETHQIVEELERLRAHIHEQFSSGESEKSEVTAKTW
KTQLSEEVFEAAPQDMKPEEAKDLPVSVSEMSVTPGEVTVTFDSSKISQEEKKVEQQVAK
DETDFVSEVSFETTPQQLQKQEVIIEFGKPAPSTAKMRAAAQGPVEEQHVVEEIPAEIQP
DVTERKEITVEVAKPETERKEMVAQPQLMTTTEEAAEEEFYDALEEHAMKDEEVSAELQT
TVPKRPESRTVQQQIETVEQTIEDFKDGPKQTSVQPEETIQELGEAERAVPESRASEQKH
ITEHMVSEDVLPDVGEETKGEEQIIVELKPSEAKGTEALTEEQQTIAEQEAAEHVAPVEE
ETKGTEEVRVDLAGAEKAAEETRTEEQKAVLEQEAAEHVAPVEEETKGTEEVRVDLAGAA
KAAEETRTEEQKADLEQEAAEHEAPIEEETKGTEEVRVDLAGAEKAAEETRTAEQKTVLE
QEAAEHVAPVEEETKGTEEVRVDLAGADKAAEETRTAEQKTITEQEAAEHVAPEEEETKG
TEEVRVDLAGAEKAAEETRAIEQKTITEQEAAEHEAPVEEETKGTEEVRVDLAGAEKAAE
ETRTAEQKTVLEQEAAEHVAPVEEETKGTEEVRVDLAGADKAAEETRTAEQKTITEQEAA
EHVAPVEEETKGTEEVRVDLAGAEKAAEETRTAEQKTVLEQEAAEHEAPVEEETKGTEEV
RVDLAGADKAAEETRTAEQKTITEQEAAEHVAPVEEETKGTEEVRVDLAGAEKAAEETRT
AEQKAVLEQEAAEHVAPVEEETKGTEEVRVDLAGAEKAAEETRTAEQKTITEQEAAEHVT
PEEEETKGTEEVRVDLAGAEKAAEETRTAEQKAVLEQEAAEHVAPIEEETKGTEEVRVDL
AGAEKAAEETRTVEQKAVLEQEAAEHVAPVEEETKGTEEVRVDLVGAEKAAEETRTAEQK
TITEQEAAEHVTPEEEETKDTEEVRVDLAGAEKAAEETRTAEQKAVLEQEAAEHVAPIEE
ETKGTEEVRVDLAGAEKAAEETRTVEQKAVLEQEAAEHVAPVEEETKGTEEVRVDLVGAE
KAAEETRTPEQKTITEQEAAEHVAPVEEETKGTEEVRVDLAGADKVTEQSRTEEQQAITI
PEMTEEVVPESRETPSSDEIVSDLAEAEKQTAETRAEEQKAPAELEEAAEVASALEEKKE
MEEVRTELTSAETQAPQTMTQEQVSLTVEESTEQTPSEVSEEAKSAKESLVELGKADEKS
EVTVQETWSEEEMQEIKQYAEEVSSVIVSQAQEILVDSITSTTPKMTLEEEQVVPVQLTQ
KFEIEETPLVQKPEEVETSEESILVTQKVETVEVPEDSLLVAPSFDNMLEDVTTREGKQV
KFQVIVRGVPTPKVTWYLDEEEIEETEETFVMTYERNVATLIILKVVPEDEGDYMVKAEN
AAGECTSTAFLQVLGPEEDKPEEEEEEEEMFEETVVEEKKSWVEVRTDLVQKPKPEDEEK
FRETITVEKPEQEVEEEEETFEETVIEDKKSWVEVRTDVVRKKPEIEQTSEETVTVQKTL
QELEMAGDTILVSQKPETIELPQEMAPEMFQETILVEKQPQPVDVEITTQKPQPQTFQEA
ISIEKGPEEGGPQERTQVEKSFEVMETEFGTTTIERQQTTTTVQFEFEKPEQRETTVEIT
ELTAPVFEIPLTDVTCRERHSVTLECRVTGVPMPQVKWYLDEDELELTSNYKVTYDRGVC
KLVILEVSDADEGEYMVKAVNEAGESTSTGYLTVEAPEKEEQPRETTEETVQIVQHVADV
TETVVEQITEVEELREAPVFTRTLHTIDTVEGKPVTFECYVTGHPEPTIKWYQENVEIQT
SDHLQISYKDGRCTLHIPSCTLEDEADYVCEAVNEAGKITTWAELFVEKETTDVEEEEEE
QTTVTEEVEETTTVTQEIIQEVTPGEIFTEQISVQAPAQQPTPVELVFEVPKEQVTEEET
IITTETTEATKPEVAPVVEEVIEEETKEVETVIEEVTEVPKPDVSEVSEETITIEKELPQ
PVSEVKPSATVGEAVELTFDVGDKLAPGVTPAEVQISFPKDEKPEQQVFEQVLQKPEEEG
VPLQKAEPEIPVQVESHREEITIGVEEKETKLLPTTEQVELTAPVVEKPEVGEAPVFVKP
LSNVTETEGKLVRFECKVTGHPKPDITWSLDEEQLVDEQVYDFIELEDGTCVLVIQETFP
EDEGEYTCKAVNQHGQATSTAELFLKAEPKAPSDVKTNEAKATEDAILAEAVEEELVDES
IAGWQSDVIPKSIEGREEQISSEADAEQAVAPATTKEQTAQLEYEIPEKVAVEAVVTQPE
EEISQKKLLTEAKTEEVASVELEITEETKPEEVSPAPSEEVPSEDKEAEKKLPSEAKTEE
QVASVELEITEETKPEEVSTAPSEEVPSEVKEAEKKLPTEAKTEEQVASVELEITEETKP
EEVSTAPSEEVPSEVKEAEKKLPTEAKTEEQVASVELEITEETKPEEVSTAPSEEVPSEV
KEAEKKLPTEAKTEEQVASVELEITEETKPEEVSTAPSEEVPSEVKEAEKKLPTEAKTEE
QVASVELEITEETKPEEVSTAPSEEVPSEVKEAEKKLPTEAKTEEQVASVELEIIKETKP
EEVSTAPSEEVPSEVKEAEKKLPSEAKTEEQVASIELEITEETKPEEVSTAPSEEVPSEV
KEAEKRLPTEAKTEEQVASVELEITEETKPEEVSTAPSEEVPSEVKEAEKKLPTEAKTEE
QVASVELEITEETKPEEVSTAPSEEVPSEVKEAEKKLPTEAKTEEQVASVELEITEETKP
EEVSTAPSEEVPSEVKEAEKKLPTEAKTEEQVASVELEITEETKPEEVSTAPSEEVPSEV
KEAEKKLPTEAKTEEQVASVELEITEETKPEEVSTAPSEEVPSEVKEAEKKLPTEAKTEE
QVASVELEITEETKPEEVSTAPSEEVPSEVKEAEKKLPTEAKTEEQVASVELEITEETKP
EEVSTAPSEEVPSEVKEAEKKLPTEAKTEEQVASVELEITEETKPEEVSTAPSEEVPSEV
KEAEKKLPTEAKTEEQVASVELEITEETKPEEVSTAPSEEVPSEVKEAEKKLPTEAKTEE
QVASVELEIIKETKPEEVSTAPSEEVPSEVKEVEKKLPSEAKTEEQVASIELEITEETKP
EEVSTAPSEEVPSEVKEAEKRLPSEAKTEEQVASIELEITEETKPREVSTVPSEEVPSEI
KEAEKKLPSETKTEEQAEVVQLEISEKVAAEAEVIQPEEEISETPQVEKEAPSVSRAEIQ
TAKVVSETTKEVQPKDTVTIPVEEIPSEVKEAEKELPSEVCKVIEIGEVKGEVPTFISEL
QDLRVKDGQPVRFVCVVSGKPNQVTWYLDRAEITDDEVYVISRSDEGVCELFIEECFPED
EGEYMVRVVNEYGEATSLAHLIVERDELDFGIIKDETDVTPAEGVPMIIIEEAPDQPIDT
LEEALEDALEEEICIPDVGTKEEEELAITAERDRWPDDDETTEEDRWPDTSHEPGKEKQF
SERLDIDVQKTQHEDEDVDTSGKVEIEVDIAGKGPSAIQLIVSKSEGPQISQVTKEIEKK
SVTETLDMATPYDEKVDSVKPAGRTLPLGSKEKPDEIETDILPTIASTKPQAPKFVTTLS
HITFKPRQQVRFQCQVIGSPKIRITWYLDEEVIEEREDIEISFTEQGICTLIIKEAHPED
QGEYMCRAVNDYGEDVTRALLTLSEDTITEEEEIYTYEEEIIEKEFYELSPEEEVLPFES
SEKIITAYTCVSPTEDVGPLFEKKDFITQSVSRTVMQFMYARLDWPQEHVLEETTLLAVE
EVGPLVLENRRIGTSIPSRAPLQFLHTTEYTHEIDETYTHLSEIKPEEEKESVTTATVPK
PQEKSPADIEDTPVEDVTIVHPTMGEEGVPLMEKAEEKEAVAPRFVESLKDLKAKPGQPV
EFEVQIIGIPKEVTWFLDEEEIEESETIEVTTKDDTSKLTIHEVTSEDEGEYMCKVVNDY
GENTTTAYLTVTEEEIESEHEEIVTDITESKVTEDTIEEIHEELHISEMEEDVPCVSEYP
LEESSEKKIPTTSEMETTYSEEISLDIPGKPEKLLPLQGIEIEIPKARVEEIMAEKTQKE
LKPTKEITAITVEVSGEKPGELLPLEEIEIEIPKEKEQEIVHEKPDIEEKPVKQPTVVTE
DVVEKKPGQSPRFVTHLSTVTAELGQPVTLTCKVAGQPKEVIWLLDEEEIVENEDVEVTR
TDEGVCRLTLHAVHPEDQGEYVCRAVNEFGTDETRAYIIVVEEDIPEVEIIEVTTDTREE
VKVEDVPEEEAFPEKPQKEERPTRETTALTVDVPGEKPDELLPVQEIEIEIPKEKEQEII
PEKPEFIEKPTRETTGITVEICGEKPGELLPLEEIEIEIPKEKEQEIVHEKPDIEEKPVK
QPTVVTEDVVEKKPGQSPRFVTHLSTVTAELGQPVTLTCKVAGQPKEVIWLLDEEEIVEN
EDVEVTRTDEGVCRLTLHAVHPEDQGEYVCRAVNEFGTDETRAYIIVVEEDIPEVEIIEV
TTDTREEVKVEDVPEEEAFPEKPQKEERPTRETTALTVDVPGEKPDELLPVQEIEIEIPK
EKEQEIIPEKPEFIEKPTRETTGITVEICGEKPGELLPLEEIEIEIPKEKEQEIVHEKPD
IEEKPVKQPTVVTEDVVEKKPGQSPRFVTHLSTVTAELGQPVTLTCKVAGQPKEVIWLLD
EEEIVENEDVEVTRTDEGVCRLTLHAVHPEDQGEYVCRAVNEFGTDETRAYIIVVEEDIP
EVEIIEVTTDTREEVKVEDVPEEEAFPEKPQKEERPTRETTALTVDVPGEKPDELLPVQE
IEIEIPKEKEQEIIPEKPEFIEKPTRETTGITVEICGEKPGELLPLEEIEIEIPKEKEQE
IVHEKPDIEEKPVKQPTVVTEDVVEKKPGQSPRFVTHLSTVTAELGQPVTLTCKVAGQPK
EVIWLLDEEEIVENEDVEVTRTDEGVCRLTLHAVHPEDQGEYVCRAVNEFGTDETRAYII
VVEEDIPEVEIIEVTTDTREEVKVEDVPEEEAFLEKPQKEERPTRETTALTVDVPGEKPD
ELLPVQEIEIEIPKEKEQVIIMKETDLEEKPVDELKGISDDGIADKSQRPPRFVTHLSTM
TAELGQPVTLTCKVAGQPKDVIWLLDEEEIVESEDVEVSRTDEGVCTLTLLAVHPENQGE
YVCRAVNEFGIDETRAYIIVVEEDIPEVEIIEERSDTMETITVQIVAEEEEFYPGKPLEG
EKPTGETAAITVTFPSEMPEELLPLQEIEIQIPKEEGQEVVLEVPESFEEVTEIVSVTTE
EIEEMGEEFLPVSEIKKSEDLSVPQTEQTTEVVTVTREDIATAPELPETELVIQPTPGEV
SRQVVDEITESFITEMEEADLHGEEERKVEDISKALLKFEETSAEVFTEESVDQFYSDLI
FVMPFENVISMPDEIDSLWQPLSRAAVQFMHTTEYLFDLETIDEDELSEGELENISEWDL
GDKTDLQLQQDVQSEMAEDLKTIISQKEDKEAVPEVATQHLEEILSEKADDGISPEKLEE
ICEAPQFVVTMTDLTFQPGQSVEFTCQLKGTPEEVNWYLDEDMLSESDTIEISPVKDGVC
KLTLLETFPEDQGQYMCRAVNEYGLAETRCDLILQQGDEVKGFEDEGVVSQEEEIPEVPQ
KVEEAPEEFPSEEMPVGAPEVLEKPDVEEEKVEDTEAEKKPEETHKADEVSEEVPSEEMP
ISAPVVPKKPDVKDEEEQITEAEKVPKVPQKADEVSEEVPSEEIAISTPDVPLKPDVKEV
EEQIAEAEKVPKVAQKADEVSEEVSSEEMTISALEAPQKPNEMEEKEQIAEAEKVLKVPQ
KADEVSEEVPLEEMAICALEVPQKPDVKEEEEQITEAEKVPKVLQKADEVSQEVPSEEMA
ISDVKEEEEQITEAEKKPAEMHKVQEVSEEVPSEEYAVTAPDISKKHEIIIKEEEISEVK
RVPEVPLRVETVSEDIPHEDIVETAPEVPEKPEVTREEITIMPEAETFGKAPYEEITFIV
PELPQKPVSDGTKVPEAARRPEMAQEVADLPEERFLKGDEFEVSVPKEEKPEEVEAQFKI
PAEEKPEDVQAEIKIPKKEKSPEQELSEKERLVVKDEEKEVAEEKELAEITEETKDIEST
RLYVAVANYEAESDEVMSLHQGELVEVLDSSRDTWWLARKQVDKKEGWAPAMYLQAKPDY
DERIKQQLTKKIDEIPVETAEEFTGDLVAPYFVTQLETMRVKDGAVARFECQIEGSPRPT
VVWYRESTEIKPSDDFKLLHEEDRCSLIIKETFPEDAGRYTVVAKNVAGVVQQTTELFID
TPLSGRTSPSRSSVSRESTAGSEADYVAPSITQKPKFQTVNEGETVTFECRLVAVPTPEI
TWFINDQPLDLEDTRYRLTVRSDVHMYTAALTIRDVTLNDAGTYKIVGSNDEGETGVAVS
LIVNKVKDEKKDFRDQLEHKEGVELKVAPEEIATPEAEQLDFRGQLKTEVKTKVGVKYEV
EQLDFRSLLKKASVKSKKFETDLVPTEEVQPEEKPEADQVDFRAVLKPAEQEAVEEETPT
IKAPEFLIPLSDLKVNEGQQARLDCQVIGNPPPDIVWYHEEEAIEEGDVYQLEWGEEGAY
SLILNEAFPEDSGEYTIKAINELGQTRSTAVLTVEALFVDEKPAAPAEQIEEIPQGPEAE
EAAVKIQAAFRGHLAREEVKHLKEEQEQVTAEIELPSAPKEEEAEFVLRPEDKPEDVEAE
LKVPEEQQEEVEQEFVLQKPEEEEVPVEVTVPVEAPVIVEKPEEQEVTEGTTVEIVCKVK
GQPKPEIKWLQDDSEIQPSEHFTMSVQEDGTASLTIVEATLDDDAEYTCVATNEAGTTQA
KTELFVNPLGEKPSFPSKLEDVEVDVGSTITLECTVHGEPQPKITWLKDGVKISEKKYKS
EFDTETGVARLTIPECSPDDEGDFTVKAINDLGTATCASMVIIMTEAPEFVQPIEDQKAA
VKTTARFECRVTGKPAPTIRWFAGQVELADNHKFKTKQEDDMAILEIHNVSLDDADMSYT
VRAYNVAGEASMTANLAVEEKEKEVVEEKPETGVAPEFVLTIKSTKVTEGQTADFSCKVT
GEPTPTLHWVYNDKELEDEGRFMIFEEEEHHHLEIYDVVPEDAGTIKVTAENTAGSASCT
ATLDVEEKPKDIPTPPKFIVNIQTTDATVGEQASLRCQAKGVPTPTLVWYKDGREIRPGD
NRYTISYDEDSTTTLMVIEVVRDVAGTYTCEATNKAGKDTTTGDLNVHEVPIQEVPEEEV
EEMVAPVIVKKPDQLTVNEKDRAEFICKITGTPAPQVTWSKGDEELTDTNKYHIEEYEDV
YCFEINQAIKEDTGDYTCTARNPAGETTCTIPLTVKAVPSEELEEVPPKVPEKEEDLSKS
PLVLRHAEQTKAPEFSQTLQDVILMEGDQLELQCAVSGVPRPEVAWDRAGKTLVPTKVMS
ISHEEDMCTLTISEVTVDQAGQYTCTAVNSAGKAICTSEVRVQERPEAPEFVRPLEKRVV
KEGKQVKMDCAVKGKPTPEITWLLNDTPIEASKRVVLDKRPTDEETVLTMTINEAVLKDS
GTVSVTAVNPAGEVKTSAELIVEAAEI
NT seq 29422 nt NT seq  +upstreamnt  +downstreamnt
atgctcagagacacccgtgtgatagagcaccacccagcgacatttgactgtcaggttctg
ggacatcctacaccaactgtcttctggaggaagaatggcaagaaactggaggaaaacatc
cgctggaaattcatttatccagaacacgagcatggaagccataccttcctgatctatgaa
acgatgcctgaagaccagggcacatatgagtgcatcgctgaaaacccgactggcaaggct
acatccgtggccaaactgactgtggaaactgccaaagttccagcaacaccagagactcca
gcccctgagcagaaagtcccccaggtggcgccaaaggtagatctcaagatggtggacctg
actgtaaaagaaggagaagtagccactttcaaatgcaagattactggatcaccaacccca
gttattacctggtacctagacaaccaggtcatcaagccatccaagtacttcaagatggag
actgtgggtcctgtccacaccctgactgtcaccgaggccttcccagaggatgaggggcag
tacaggtgtactgctgtcaaccccagtggagaggcttctaccacagcctacctcaacata
ataatgcctgttacagaagaagaaaaaccaccagctgaggaggttgaaggaccacgtttc
atcaagcctattgccagtgtggacatcatggagggcaaccctgtcacttttgaagctcaa
attgaaggcaagcctgcccccgaggtcacctggttcagagagggtgtggccattaaacct
tcagccgacttccagattctcaaagaaggcaaccgcgcagtcctgatcattaaagaggca
ttcccagaggattctggcattatcaccatccagatcaagaactctgtgggtgtggccgaa
tgctctgcacagctctatgtggaagaagaagttagctcccatgaaaaggaggttactgat
gctacatatgtgctgcagatgccagatatagatcaagaggaaagggaactcactgagaag
atcatatctgaagaggagctcgaaaaagaccagcagagagaggttgaggtccgcattggc
aagatttctcagccaatcaaaccagctgttatcaaacctatagtcccaacaatcactgta
ggcagaggaaagactgccagacttgatgtccaggttgcaagtttcccacctcccaaattt
aaatggtttgtcaacggcatggagattgttccatccaagaagttccaggtttttatggaa
ggcagtgtcatctctctgattatagtcaacgttgacgagaaggaccttggcgagtatgtg
ctccgggtctggaatgatatgggagaagttgtctgcaagaccactctcaacataccagct
tcagaaaaggaggttgtaatcacaatgcctccagaattcaagaagccacctaaacaagag
gtcaagacgcagccaggaaaagtagccaagattgaatgcttggtccaggcctacccacca
ccaaaggttacttggtacaaggacaaggacatagaactccagcagtcttctaaataccag
atgaccaccaaggaacatgtggtcattaatgagcgtatctgtatcttgaccatcaatgat
atccagcctgaagacactggggattacactgtccgtgctgagaacaagcttggtgaagta
acctgtaggacttctctggtcattgctcctgaaactaaggatatagaattggttgaggga
gtggagacagtcaccaccaccacagtgactgagaaagtgaccagaaccatggactatact
gaggaggaagaggacaggaggatgactgtcaccagaggtcctccacagttcacagagcca
ctgaaacctgagatcagagtgcctgtcagaggcattgccagactggagtgtgttgtccag
gcccagccaccacccattgtgtcctggtatgttaatggagaggagctgtacccaggtcct
cactatgaaatcttgactgaggatgacaaggctgtcttgcttatcattgatgttggtcct
caggatactggagagtatacatgtagggccaagtctgaggaaggagaggccatcagcagt
actactctctatgttgaaccagaaagagccgtagaacagcaaccacctagcaaagaagaa
gagatgatcccaccagagttcaccaagcccttggagccattcgttgccactgatggtgat
gaagttgtcatgcgcatcaatgtcaccggcaaacctgcaccatcagtctcctggtacttc
aatgacaactgcattgatgacagcgaggatttcatcatcaagtataacccagacactggg
gacagtgtcttgactattgtggaggtgttccctgaagaccaaggagagtacaaatgtgtg
gctctgaaccctgtgggagaggctgtctgcgtggctgggctgcaggtgctggatgtgatc
tctacaactgaagaggaacccatgcctgatgtcatgacaatgtctgccacgagtgagaca
atagaacaagcctatgaagcagaacaggctgctttcaccattcagatccctgcaatggga
cctgaagaggaagagcaggagatggaggtggaagagaccccagagattgtcatagaagag
agaagagaggtagtcactacaaccacggatgacacggaggaagctttcactgtagagatt
gttgcagaagaagaggcaccagaagaggaagtgccagaggaaaaaccagctgttgttgag
gtgccagtatcaaaaccagaagaggcaccaaaagaggctccagtggaagagaaaccagct
gtccggattgccacagaggctaaagcagagccaacaccagaggttgctccttctcaagag
gtggagatgactttgcaggtgaaacaggagcctgtaactcccagcccaactcctattact
ggcgaagaacaattggaaactgctgatgtgactcaggtaattggagctgtgcagcaaatc
ttgattgataccaaagggaaggaagatgtcgccatagacagcactaccagaactgaagag
actatcacacaggatcaggtggatgcaccttccagggtcactgagaccattaccgtggag
aaagaccaacaacctgaggctgttgagatgcaatttgtcatcgaagaacagccacaagtc
acagaggaagtcacgagggtcgagactcaggtgacagaggtacgggaagagatgattcca
cctaaattcactgtccccatcaaaccccaggcagtcaaggatggcgatgaggtgaccttc
acctgtactgtgattgggaaacccactcctaaaatcacctggtacaaggatcataaagag
tttgatttgaacagcgatatgaggatcgcttttgatgaagagactggagttgccacattt
gagttgttgtttgttacccaagatgatcaggccatctacactgtgtgtgctgagaaccct
gctggcaaggccacagtcacagctaacttgattgtgctgcctgctgatgctggccccatc
acctccactactaccacagtgatggagaaggaaggcatagtggtcatggatgagagaggt
cctcagtttaccaagatgccagagccagtgcaggtcacagaggggcaggatgctaagttt
gaaattcaagttactggaagcccggtgccaacagttacctggtacaagagtggtgtggag
atccacccctcagacagagtgaccattactgttgacagtggcctgtctgttctgaacata
agcaaggtcactccagatgacagtggtgactatgcggtcaaagcggtcaatgagtttgga
gagatgacctgcaggacaatgctgataataaggaaggtacaagaagagatgcacccacca
aaattcaccaagcctataaagccacaggttgttcaagatggtgaggatgtgacattcagt
gcagtggtcactggaaaaccaacaccagaagtcacttggtatagggaccaggtggttatc
acccccaacgaggacatttccattacttttaatgaagaaactggtgaatgcacactgtta
ttacgtgaagttttcccagaggacagtgctgtatacactattactgccactaaccctgct
gggaaagctaccattacagccaacctggttgtgactgaaaaaatggaggaaactgtagaa
gtgatccaggttcagccagagaaaatggatgtgtctgagaccagggaagtgaccagagtg
gtccagcaggaggttgtggatgaggcaggtgacatgcagccccccaggttctcaaagcct
attcagccacaggttgtgaatgatggtgatgatgtgacattcagctgtgttgtcactggt
caacctaccccagaggtcacatggtacagggaccaggagaaactgacccccaatgaggat
ataaccatcacgtataaagaagagactggtgaatgtactcttttgatgtatggtatcttt
cctgaagatgctgccgtttattctgtgacagccaccaacccagtgggcaaagctaccatc
tctgccaatttgattgtgcagagtccagaagagggtcctatcattgagaccacaactact
gtaatcaagaaagaaaccatctcacagatttccgagtcggaaggtgagacagagaggcac
ttgactgtaattgagcagcaatccccagagttcaccaagacactgaagcagacgacagag
gtcacagagggagaaactgctgtactcaaagttgagatagaggctgagcccaagcctaag
gtcacatggcatgtcaatgggctggaggtcatgcccagcaaacaccttcaggtggatgtc
atggagaaagtctctgtgttgaagatatttaatgtgacacctgaggatgcaggggactat
gtatgcaaggctgagaatgagctgggagagatgtcttgtactaccactcttgttgttaac
aagccaaagactgttgaacttaaaccagcccctggggataaggtcccagtgacagaaaaa
ccagagcaggctactgcaggcaagctaccagcctcatcagaatcttcctcaaaatctgag
tctgaacaagaaaaattccctgaaaaagagggtgaacgttccccaacagagccagttgaa
atgcctgtagaagaacaagtgccagaagaacagccagttgtgattggtgaggcaccagac
ttcatcaagcctctctgctcacagaatgtcatggatggagacagtgtcactttccatgtg
aaattcacaggttacccagcaccaacaatcacatggtttcataataaaaaacttgttgaa
ccagggcctgacttcagactgggcactgaccgtgaaagaggggacagcatccttctgatc
ccagaggtcttccctgaggataaaggagaatacatggcaatagcagtcaatgactttggc
atggctgagacaacatgcaggctcattataataacatcagaatcggagcagtcctttgat
tcctctgaagaagagaaatcttacaaagtggtaaaagatacagatgttcatacccagatg
acacagatatctcagcaacagctgccggaggagcttcaaatccggatccagtctccagaa
cagcctgttccaggagaagaagatgaggagcattaccaggagacagtggaggtccaggag
tacagagacgcctctcaggaatacgagatcaaatttgaaccacacaagccagtcacaagc
acggcggaagtgcagcaagttttacaaccacagcctcaagggtacaagatggacattgaa
atccagggtgcccccagtgagaccagctccattgtggtgcagccaaaaagtgaagaggtt
tctcctgaagtacgccagactcagcaagtcattatcagtttggaacacccagagaaaaag
agcaccgaggtgcgcagagaggagactcacacagaagaggttgatgggacagtgaaacat
gaaatccgtaccatggtatccaaagagagtgaaatcacaacatcagatgtggaagagaca
gaggagtactggactgagactttgtccgagtcagagaaagaagttatgctgcaggaagag
tatgtggtgccagaggaagtccctgagtgggcagtagcaccacagttcacttggggtctc
atgtctcttaaagtcatggatggagaggaggtgaaattttgctgtgaagtcactggcact
ccctcacccacaatcacctggtacaagaacaataaactgcttaaagagaaccaggacttt
aagatggagtatagcccagagtctcactcctgcactctgatgatagtagaagtcttccct
caagattctggagaatacaagtgtgtggctaggaatattgcaggccaggctataacatct
gctatgctggaggttgaatcctatgaatatgttgctgatacggaagaagcttcagaatcc
ttgatgtcatcagcctcagtagggtcagcttccccagtcaggcttgccagcactgatcag
gtcacattgctgtcagaaacacaccaaattgtcgaagaactagagagactcagagcccac
attcacgagcagttttccagtggagaatctgaaaaatcagaggttacggccaaaacttgg
aagactcagctttctgaagaggtgtttgaagctgctcctcaagacatgaaacctgaggaa
gccaaggacttacctgttagtgtctcagaaatgtctgtaacaccaggagaagtcacagtt
acctttgattcttccaaaatttctcaggaagagaagaaagttgagcaacaagtagccaaa
gatgaaacagactttgtgagtgaggtatcttttgagactactcctcagcagttacagaaa
caagaggttatcattgaatttggaaaaccagctccatcaacagcaaaaatgagggctgca
gctcaagggccagttgaggaacaacacgttgttgaagaaataccagcagaaatccaacca
gatgttactgagagaaaggagatcacagttgaagtagcaaagccagagactgaacgtaaa
gaaatggtagcacaacctcagctaatgacaacaaccgaagaggcagctgaagaggaattc
tatgatgctctggaagaacatgccatgaaagatgaggaagtgtcagctgagcttcaaacc
actgttccaaaaaggccagagtctaggacagtacaacagcaaattgaaacagttgaacaa
acaatagaagacttcaaagatggtcctaaacagacttctgttcaacctgaagaaactata
caagaacttggggaagctgaaagagctgtgcctgaaagtagggcatcagagcaaaagcac
atcactgaacacatggtttcagaagatgttttgcctgatgtgggtgaagaaacaaagggt
gaagagcagataattgttgaattaaaaccctctgaagcaaaaggtaccgaagctcttact
gaagaacaacaaacaattgctgaacaagaggctgctgaacatgtggctccagttgaagaa
gaaaccaaaggcactgaagaagtcagagttgatttggctggtgctgaaaaagctgcagaa
gaaactagaacagaagaacaaaaggcagtcttagaacaagaggctgctgaacatgtggct
ccagttgaagaagaaaccaaaggcactgaagaagtcagagttgatttggctggtgctgcg
aaagctgcagaagaaactagaacagaagaacaaaaggcagacttagaacaagaggctgct
gaacacgaagctccaattgaagaagaaaccaaaggcactgaagaagtcagagttgatttg
gctggtgctgagaaagctgcagaagaaactagaacagcagaacaaaagacagtcttagaa
caagaggctgctgaacatgtggctccagttgaagaagaaaccaaaggcactgaagaagtc
agggttgatttggctggtgctgacaaagctgcagaagaaactagaacagcagagcaaaag
acaatcacagaacaagaggctgctgaacatgtggctccagaggaagaagaaaccaaaggc
actgaagaagtcagagttgatttggctggtgctgagaaagctgcagaagaaacaagagca
atagaacaaaagacaatcactgaacaagaggctgctgaacatgaggctccagttgaagaa
gaaaccaaaggcactgaagaagtcagagttgatttggctggtgctgagaaagctgcagaa
gaaactagaacagcagaacaaaagacagtcttagaacaagaggctgctgaacatgtggct
ccagttgaagaagaaaccaaaggcactgaagaagtcagggttgatttggctggtgctgac
aaagctgcagaagaaactagaacagcagagcaaaagacaatcacagaacaagaggctgct
gaacatgtggctccagttgaagaagaaaccaaaggcactgaagaagtcagagttgatttg
gctggtgctgagaaagctgcagaagaaactagaacagcagaacaaaagacagtcttagaa
caagaggctgctgaacatgaggctccagttgaagaagaaaccaaaggcactgaagaagtc
agggttgatttggctggtgctgacaaagctgcagaagaaactagaacagcagagcaaaag
acaatcacagaacaagaggctgctgaacatgtggctccagttgaagaagaaaccaaaggc
actgaagaagtcagagttgatttggctggtgctgagaaagctgcagaagaaactagaaca
gcagaacaaaaggcagtcttagaacaagaggctgctgaacatgtggctccagttgaagaa
gaaaccaaaggcactgaagaagtcagggttgatttggctggtgctgagaaagctgcagaa
gaaactagaacagcagaacaaaagacaatcacagaacaagaggctgctgaacatgtgact
ccagaggaagaagaaaccaaaggcactgaagaagtcagagttgatttggctggtgctgag
aaagctgcagaagaaactagaacagcagaacaaaaggctgtcttagaacaagaggctgct
gaacatgtggctccaattgaagaagagaccaaaggcactgaagaagtcagagttgatttg
gctggtgctgagaaagctgcagaagaaactagaacagtagaacaaaaggcagtcttagaa
caagaggctgctgaacatgttgcaccagttgaagaagaaaccaaaggcaccgaagaagtc
agggttgatttggttggtgctgagaaagctgcagaagaaactagaacagcagagcaaaag
acaatcacagaacaagaggctgctgaacatgtgactccagaggaagaagaaaccaaagac
actgaagaagtcagagttgatttggctggtgctgagaaagctgcagaagaaactagaaca
gcagaacaaaaggctgtcttagaacaagaggctgctgaacatgtggctccaattgaagaa
gagaccaaaggcactgaagaagtcagagttgatttggctggtgctgagaaagctgcagaa
gaaactagaacagtagaacaaaaggcagtcttagaacaagaggctgctgaacatgttgca
ccagttgaagaagaaaccaaaggcaccgaagaagtcagggttgatttggttggtgctgag
aaagctgcagaagaaactagaacaccagagcaaaagacaatcacagaacaagaggctgct
gaacacgttgctccagttgaagaagaaaccaaaggcaccgaagaagtcagggttgacttg
gctggtgctgataaggttacagaacaatcaagaacagaggaacaacaggcaatcacaata
ccagagatgacagaggaggttgttcctgaaagtagggaaacaccttcttcagatgagata
gtaagtgaccttgctgaagcagaaaaacaaactgcagagactagagctgaagaacagaaa
gctccagcagagctagaagaggcagctgaagttgcatctgctctggaagaaaagaaggag
atggaggaagtaagaacagagttaacatcagcagagacacaagccccacaaacaatgaca
caggaacaggtctcattaactgttgaagaatctactgaacagacacctagtgaggtctca
gaggaagctaagagtgccaaagaatctttggttgaattaggtaaagctgatgagaaatct
gaagtcacagtgcaagaaacctggagtgaggaggaaatgcaggagataaaacaatatgca
gaagaagtatccagtgttattgtgtctcaagcacaagagatattggtagactctatcaca
tcaactactccaaaaatgaccttggaagaagaacaagttgttcctgttcagctaactcag
aaatttgaaattgaagaaaccccattggttcagaaaccagaagaagttgaaacctccgaa
gaaagtattctagtaacacaaaaggtggagactgttgaggtgcctgaggatagcctacta
gttgcgcctagctttgataacatgctggaagatgttaccaccagggaaggaaaacaagta
aaattccaggtcattgttagaggagtaccaacacctaaagtcacatggtatttggatgaa
gaagaaatcgaagaaactgaagaaacatttgtaatgacttatgagcgcaatgtagccaca
cttattatcttgaaagttgtacctgaggatgaaggagattacatggttaaggcagagaat
gcagcaggagagtgtacatccactgcgtttcttcaagtgcttgggcctgaagaagataag
ccagaagaagaggaggaggaagaagaaatgttcgaggaaactgttgtggaagaaaagaaa
tcatgggttgaggtgagaactgatcttgttcagaaaccaaaacccgaggatgaagagaaa
tttagagagaccatcactgttgaaaaacccgaacaagaagtggaagaagaagaggaaaca
tttgaagaaactgttatagaagacaagaaatcttgggtggaggtcagaactgatgttgtc
cgaaagaaaccagaaatagagcagacatctgaggagactgtaactgttcaaaaaacactc
caagaattggagatggcaggagacactatactggtttcacaaaaaccagaaacaatagaa
cttccccaagaaatggcgcctgagatgttccaagagaccatcttggttgaaaaacaacca
caaccagttgatgttgaaataactacacaaaagccacaaccacaaacattccaagaagct
atctccattgagaaaggcccagaagaaggaggcccacaggagagaacacaagttgaaaaa
tcttttgaggttatggaaacagaatttgggacaactacaattgaaaggcagcagacaact
accacagtgcagtttgaatttgaaaagccagaacaaagggagacaacagtagaaataaca
gagttgacagcacccgtgtttgagataccattgactgatgtcacttgccgagagaggcac
tcagtcactctagaatgccgagtcactggggtccccatgcctcaggtgaaatggtactta
gatgaagatgaactagaacttacttccaactacaaagtcacttatgatagaggtgtctgt
aagctggttatacttgaggtatcagatgcagatgaaggggagtacatggtgaaagctgtc
aatgaagctggtgagagcacctccacaggatatctcactgtagaagcacctgaaaaagaa
gaacaaccaagggagacaactgaggagacagtccaaattgttcaacatgtggctgacgtg
acagaaacagtggttgaacaaatcacagaagttgaggagctcagagaagctcctgtcttc
actagaactcttcacactatagatacagtagaaggcaagccagtgactttcgaatgttat
gtcactggtcaccctgagccaacgattaagtggtatcaggagaatgttgagatccagacc
agtgatcacctgcagataagttacaaagatggccgttgcacacttcacatacccagctgt
acactggaggatgaagcagactatgtgtgcgaggccgttaatgaagctggcaaaattaca
acatgggccgaacttttcgttgaaaaagagaccacagatgttgaagaagaagaagaagaa
caaacaactgtcacagaagaagtagaggaaactaccacagttacccaagaaataatccaa
gaagttacaccaggggagatctttactgaacagatttctgttcaggcacctgcacagcag
cccactccagtagaactggtatttgaagtaccaaaagaacaagtcactgaagaagaaaca
attattacaacagaaacaactgaagctaccaaacctgaagttgccccagttgtggaagag
gttattgaagaggaaacaaaagaagtagaaactgtcattgaagaagtaacagaggtacct
aagcctgatgtgtctgaggtatcagaagagaccatcactatagaaaaggaactaccacag
cccgtgtctgaagttaagccatctgcgacagttggtgaagctgtggagttgacatttgat
gtgggagacaagttggcacctggagtaaccccagctgaggtccagatttccttccccaag
gatgagaaaccagagcaacaggtatttgaacaggtgctacagaaaccagaggaggagggt
gttcctctccaaaaggcagagcctgaaatccctgtacaagtagagtctcacagagaagaa
ataacgattggtgtagaggaaaaagaaaccaaactcctccccacaacagaacaggttgaa
ctaacagccccagttgtagagaaacctgaagttggtgaggcacctgtctttgtcaagcca
cttagtaatgtaacagaaactgaaggaaagcttgtccgatttgaatgcaaagttactggt
catccaaagccagatatcacttggtcacttgatgaagaacagcttgtcgatgagcaagtg
tatgatttcattgaacttgaagatggaacctgtgtactggtcatccaagaaacattccct
gaagatgaaggggaatatacctgtaaggctgtcaaccaacatggacaggcaaccagcact
gcagagctgttcctgaaagcagaaccaaaggctccaagtgatgtaaagacaaatgaagct
aaagcaacagaagatgccatattagctgaagcagtggaagaagaattggttgatgaatca
attgcagggtggcagtcagatgtgattcccaaatctatagaaggaagagaagaacagatt
tcatctgaagctgacgcagagcaggctgttgcaccagctacaacaaaagaacagacagca
cagttggaatacgaaattccagaaaaagttgctgtagaggctgtagtcacacagcctgaa
gaagaaatttcacaaaagaaattgcttactgaagccaaaacagaagaggtggccagtgtt
gaacttgagatcacagaggaaactaagcctgaggaggtatctcctgctcctagtgaggaa
gtaccatctgaggataaggaggcagaaaagaaattgccttctgaagccaaaactgaagaa
caggtggccagtgttgagcttgagatcacagaggaaactaaacctgaggaggtatctact
gctcctagtgaggaagtaccatctgaggttaaggaggcagaaaagaaattgcctactgaa
gccaaaacagaagaacaggtggccagtgttgaacttgagatcacagaggaaactaagcct
gaggaggtatctactgctcctagtgaggaagtaccatctgaggttaaggaggcagaaaag
aaattgcctactgaagccaaaaccgaagaacaggtggccagtgttgaacttgagatcaca
gaggaaactaagcctgaggaggtatctactgctcctagtgaggaagtaccatctgaggtt
aaggaggcagaaaagaaattgcctactgaagccaaaaccgaagaacaggtggccagtgtt
gaacttgagatcacagaggaaactaagcctgaggaggtatctactgctcctagtgaggaa
gtaccatctgaggttaaggaggcagaaaagaaattgcctactgaagccaaaacagaagaa
caggtggccagtgttgaacttgagatcacagaggaaacaaagcctgaggaggtatctact
gctcctagtgaggaagtaccatctgaggttaaggaggcagaaaagaaattgcctactgaa
gccaaaacagaagaacaggtggccagtgttgaacttgagatcataaaggaaacaaagcct
gaggaggtatctactgctcctagtgaggaagtaccatctgaggttaaggaggcagaaaag
aaattgccttctgaagccaaaacagaagaacaggttgcctctattgaacttgagatcaca
gaggaaactaagcctgaggaggtatctactgctcctagtgaggaagtaccatctgaggtt
aaggaggcagaaaagagattgcctactgaagccaaaaccgaagaacaggtggccagtgtt
gaacttgagatcacagaggaaactaagcctgaggaggtatctactgctcctagtgaggaa
gtaccatctgaggttaaggaggcagaaaagaaattgcctactgaagccaaaacagaagaa
caggtggccagtgttgaacttgagatcacagaggaaactaagcctgaggaggtatctact
gctcctagtgaggaagtaccatctgaggttaaggaggcagaaaagaaattgcctactgaa
gccaaaacagaagaacaggtggccagtgttgaacttgagatcacagaggaaactaagcct
gaggaggtatctactgctcctagtgaggaagtaccatctgaggttaaggaggcagaaaag
aaattgcctactgaagccaaaacagaagaacaggtggccagtgttgaacttgagatcaca
gaggaaactaagcctgaggaggtatctactgctcctagtgaggaagtaccatctgaggtt
aaggaggcagaaaagaaattgcctactgaagccaaaacagaagaacaggtggccagtgtt
gaacttgagatcacagaggaaactaagcctgaggaggtatctactgctcctagtgaggaa
gtaccatctgaggttaaggaggcagaaaagaaattgcctactgaagccaaaacagaagaa
caggtggccagtgttgaacttgagatcacagaggaaactaagcctgaggaggtatctact
gctcctagtgaggaagtaccatctgaggttaaggaggcagaaaagaaattgcctactgaa
gccaaaacagaagaacaggtggccagtgttgaacttgagatcacagaggaaactaagcct
gaggaggtatctactgctcctagtgaggaagtaccatctgaggttaaggaggcagaaaag
aaattgcctactgaagccaaaacagaagaacaggtggccagtgttgaacttgagatcaca
gaggaaactaagcctgaggaggtatctactgctcctagtgaggaagtaccatctgaggtt
aaggaggcagaaaagaaattgcctactgaagccaaaaccgaagaacaggtggccagtgtt
gaacttgagatcacagaggaaactaagcctgaggaggtatctactgctcctagtgaggaa
gtaccatctgaggttaaggaggcagaaaagaaattgcctactgaagccaaaaccgaagaa
caggtggccagtgttgaacttgagatcataaaggaaacaaagcctgaggaggtatctact
gctcctagtgaggaagtaccatctgaggttaaggaggttgaaaagaaattgccttctgaa
gccaaaacagaagaacaggttgcctctattgaacttgagatcacagaggaaactaagcct
gaggaggtatctactgctcctagtgaggaagtaccatctgaggtaaaggaggcagaaaaa
agacttccatcagaagccaaaacagaagaacaggtcgctagtattgaacttgagatcaca
gaggaaacaaagcctagagaggtatctactgtacctagtgaggaggtaccctctgaaatt
aaggaggctgaaaagaaacttccatcagagacaaaaactgaagagcaagcagaagttgtc
caacttgagatttcagagaaggtagctgcagaagctgaagttatacaaccagaagaagaa
atttctgaaactccacaagttgaaaaagaagcaccctcagtctcaagagctgaaattcaa
acagccaaggttgtttcagaaacaacaaaggaagtgcaaccaaaagatacagttacaatt
cctgtggaagaaattccttctgaagttaaggaggcagaaaaggaattgccttctgaagtt
tgtaaggttattgagataggggaggtcaaaggtgaggttccaacattcatatctgagtta
caagatttaagggtaaaagatggacagcctgtaaggtttgtgtgtgttgtgtcaggtaaa
cctaaccaagtgacatggtatttagatagggctgagattacagatgatgaggtttatgtg
atatcacgtagtgatgagggagtgtgtgaactttttattgaggaatgttttcctgaggat
gagggtgagtacatggtaagagtggttaatgaatatggggaggctacctctttggctcat
ttgatagttgaaagggatgagttagattttgggatcataaaagatgaaacagatgtcacc
ccagctgaaggagtccctatgataattattgaagaagcccctgaccaaccaattgatacc
ctcgaagaagcattggaagatgctttagaagaagaaatctgcataccagatgttggaact
aaggaagaggaggagttggcaatcactgctgaaagagataggtggcctgatgatgatgaa
acaacagaggaggataggtggcctgacacctcacatgaacctggaaaagaaaaacagttt
tctgaaagactagatattgatgtgcagaaaactcagcatgaggatgaagatgttgacacc
agtggaaaagtagaaattgaagttgatattgcaggtaaaggtccatctgcaattcaactg
attgtttcaaaatcagaaggtccccaaatttcccaagtaactaaagaaatcgaaaagaaa
tctgtaactgagaccttagatatggccactccctacgacgaaaaagtagattcagtgaag
cctgcaggtagaactttgcctttaggaagtaaagaaaaaccagatgaaattgaaactgat
atattacctaccatagcttccacaaaaccacaggcaccaaagtttgtaacaacattgtcc
catataacattcaaaccaaggcaacaagttcgctttcagtgtcaagtcattggatcaccc
aaaataaggattacttggtatcttgatgaagaggtaattgaagaaagggaagatattgaa
atatctttcacagaacaaggcatttgtacactaatcattaaggaggcacaccctgaagat
cagggtgaatatatgtgcagggcagtcaacgattatggtgaggatgtgaccagggcactt
ttgaccctctcagaggacacaattacagaagaggaagagatctatacttatgaagaagag
atcatagaaaaggagttctatgaattgtctcctgaggaggaggttctcccatttgaatca
tctgagaaaataatcactgcatacacatgtgtgagtcctactgaggatgtggggccttta
tttgagaagaaagacttcataactcagagtgtgagccgcactgttatgcagttcatgtat
gctaggttggactggccacaggagcatgtattagaggaaactaccctgcttgctgtagaa
gaggtagggcctcttgtcttggagaataggcgtattggtactagcattccctcaagggca
ccactgcagttcttacacactacagagtatactcatgaaattgatgagacatatactcat
cttagtgaaatcaaacctgaagaagaaaaagaatccgtaacaacagcaacagtgccaaaa
cctcaagaaaaatctccagctgacattgaagacacacctgttgaagacgtcacaatagta
catccaacaatgggtgaagagggtgtacccttgatggaaaaagctgaagaaaaagaagct
gtggcacccagatttgtggagtctttaaaagacttaaaagcaaagcccggacaacctgta
gagtttgaagtgcagattatagggataccaaaagaagtcacctggttcttagatgaggaa
gagatagaggagagtgagacaattgaagtaactaccaaagatgacacttcaaaactaaca
atccatgaggtaacttcagaagacgaaggggaatacatgtgtaaagtggtgaatgattat
ggtgaaaataccacgacagcttatctcacggtcacagaagaagaaattgagtctgagcat
gaggaaatagttactgatattactgaatccaaagtaactgaagatacaatagaggagata
catgaagaattacatatatctgaaatggaagaggatgtcccatgtgtgtcagaataccct
ttagaagagtcttctgagaaaaagatccctaccactagtgagatggaaactacctacagt
gaggaaatcagccttgatattcctggcaaaccagagaagttgcttccactacaagggatt
gaaattgagatacccaaagcaagagtagaagaaataatggctgaaaaaacacaaaaagaa
ttgaagccaacaaaagaaatcactgctattacagtagaagtctctggtgaaaagcccggt
gaactgctacctctagaagaaatagaaattgagataccaaaggagaaagaacaggaaata
gttcatgaaaaaccagacatagaggaaaaacctgtcaaacaaccaacagttgtgacagag
gatgtggttgaaaagaaaccaggacaatctccaagatttgtaacacatctcagcactgtg
actgcagaactgggtcaacctgtaactcttacatgcaaagtggctggacaacccaaagaa
gtcatttggcttctggatgaagaagaaattgtagaaaatgaagatgtagaagtgacaaga
acagatgaaggtgtctgcagacttacactgcatgccgtgcaccccgaagatcaaggggaa
tatgtgtgcagggctgtgaatgaatttggaacagatgagaccagagcttacatcatagtg
gtagaagaggatatcccagaggttgaaattatagaggtcacaactgacactagagaagag
gtaaaagttgaagatgtgccagaagaagaagcatttccggagaagccacaaaaagaggaa
aggccaacaagagaaaccactgctcttacagtggacgtccctggtgaaaagccagatgaa
ctgttacctgtacaagaaatagaaattgagatacccaaggaaaaagaacaggaaatcatt
cctgaaaaacctgagtttattgaaaaaccaacaagagaaaccactggtattacagtggaa
atctgtggtgaaaagcccggtgaactgctacctctagaagaaatagaaattgagatacca
aaggagaaagaacaggaaattgttcatgaaaaaccagacatagaggaaaaacctgtcaaa
caaccaacagttgtgacagaggatgtggttgaaaagaaaccaggacaatctccaagattt
gtaacacatctcagcactgtgactgcagaactgggtcaacctgtaactcttacatgcaaa
gtggctggacaacccaaagaagtcatttggcttctggatgaagaagaaattgtagaaaat
gaagatgtagaagtgacaagaacagatgaaggtgtctgcagacttacactgcatgccgtg
caccccgaagatcaaggggaatatgtgtgcagggctgtgaatgaatttggaacagatgag
accagagcttacatcatagtggtagaagaggatatcccagaggttgaaattatagaggtc
acaactgacactagagaagaggtaaaagttgaagatgtgccagaagaagaagcatttccg
gagaagccacaaaaagaggaaaggccaacaagagaaaccactgctcttacagtggacgtc
cctggtgaaaagccagatgaactgttacctgtacaagaaatagaaattgagatacccaag
gaaaaagaacaggaaatcattcctgaaaaacctgagtttattgaaaaaccaacaagagaa
accactggtattacagtggaaatctgtggtgaaaagcccggtgaactgctacctctagaa
gaaatagaaattgagataccaaaggagaaagaacaggaaattgttcatgaaaaaccagac
atagaggaaaaacctgtcaaacaaccaacagttgtgacagaggatgtggttgaaaagaaa
ccaggacaatctccaagatttgtaacacatctcagcactgtgactgcagaactgggtcaa
cctgtaactcttacatgcaaagtggctggacaacccaaagaagtcatttggcttctggat
gaagaagaaattgtagaaaatgaagatgtagaagtgacaagaacagatgaaggtgtctgc
agacttacactgcatgccgtgcaccccgaagatcaaggggaatatgtgtgcagggctgtg
aatgaatttggaacagatgagaccagagcttacatcatagtggtagaagaggatatccca
gaggttgaaattatagaggtcacaactgacactagagaagaggtaaaagttgaagatgtg
ccagaagaagaagcatttccggagaagccacaaaaagaggaaaggccaacaagagaaacc
actgctcttacagtggacgtccctggtgaaaagccagatgaactgttacctgtacaagaa
atagaaattgagatacccaaggaaaaagaacaggaaatcattcctgaaaaacctgagttt
attgaaaaaccaacaagagaaaccactggtattacagtggaaatctgtggtgaaaagccc
ggtgaactgctacctctagaagaaatagaaattgagataccaaaggagaaagaacaggaa
attgttcatgaaaaaccagacatagaggaaaagcctgtcaaacaaccaacagttgtgaca
gaggatgtggttgaaaagaaaccaggacaatctccaagatttgtaacacatctcagcact
gtgactgcagaactgggtcaacctgtaactcttacatgcaaagtggctggacaacccaaa
gaagtcatttggcttctggatgaagaagaaattgtagaaaatgaagatgtagaagtgaca
agaacagatgaaggtgtctgcagacttacactgcatgccgtgcaccccgaagatcaaggg
gaatatgtgtgcagggctgtgaatgaatttggaacagatgagaccagagcttacatcata
gtggtagaagaggatatcccagaggttgaaattatagaggtcacaactgacactagagaa
gaggtaaaagttgaagatgtgccagaagaagaagcgtttctggagaagccacaaaaagag
gaaaggccaacaagagaaaccactgctcttacagtggacgtccctggtgaaaagccagat
gaactgttacctgtacaagaaatagaaattgagatacccaaggaaaaagaacaggttatc
attatgaaagaaacagatttggaggaaaagccagtagacgagctcaagggtatttcagat
gatggaatagcagacaaatcacagcggccacctagatttgtaacacatctcagcactatg
actgcagaactaggtcaacctgttactcttacatgcaaagtggctggacaacctaaagat
gtgatttggcttttggatgaagaagaaattgtagaaagtgaagatgtagaagtgtcaaga
acagatgaaggtgtttgcacacttacactacttgctgtgcaccctgaaaatcaaggagaa
tatgtgtgcagagctgtgaatgagtttggtattgatgagacaagggcttacatcatagtg
gtagaagaggatatcccagaagttgaaattattgaagagagatcagatacaatggagaca
ataactgtccaaattgtagctgaggaagaggaattctatcctggcaagccactggagggg
gagaagccaacaggagaaacagctgctataacagttactttcccaagtgaaatgcctgag
gaattgctacctctgcaggagatagaaattcagatacctaaggaagaggggcaagaagtt
gttcttgaggtaccagaaagctttgaggaagtgactgaaatagtcagtgtaaccactgaa
gaaattgaagagatgggtgaagaatttcttccagtcagtgaaattaaaaaatcagaggac
ctttctgtgccacaaacagaacaaactacagaagttgtcaccgttactagagaagacatt
gctacagcacctgaattgcctgagactgaacttgttattcaacctacaccaggtgaggta
tctcgtcaggtagtagatgaaataacagagtcctttattacagaaatggaagaagctgat
ttacatggagaagaggaaagaaaagtagaggacattagcaaggcattgttaaaatttgaa
gaaacttctgcagaggtatttacagaggaatcagtggatcagttttattctgatttaata
tttgtaatgccatttgaaaatgtcatctctatgcctgatgaaatagattctctgtggcag
ccattatctagagcagctgtacagttcatgcacacaacagagtacctgtttgatcttgag
actattgatgaggacgaactatcagaaggtgaacttgaaaacatttcggagtgggatctt
ggagataaaactgacctccaattacagcaagatgttcagtctgaaatggcggaagatctg
aagacaattatttcacaaaaggaagataaggaagctgtacctgaagttgcaacacagcat
ttggaggaaattctctcagaaaaagctgatgatggaatttctccagaaaaactggaagaa
atctgtgaggctccacaatttgttgttacaatgactgacttgaccttccagcctggtcaa
tctgtggaattcacatgccaattgaaaggcactccagaagaggtaaattggtatctggat
gaggacatgctctcagaaagtgatactatagaaataagtccagttaaagacggtgtatgc
aaattaactctattggaaacctttcctgaagaccagggtcagtatatgtgtagggcagtt
aatgaatatggtcttgctgaaacaagatgtgatcttatccttcagcaaggggatgaggta
aaaggttttgaggatgaaggagtggtatctcaagaagaagagataccagaagtgcctcag
aaagttgaggaggcacctgaagagttcccatctgaggaaatgcctgttggtgcccctgag
gttcttgagaaacctgatgtggaggaagagaaagttgaagacactgaggcagagaagaaa
ccagaggagacccataaagctgatgaggtatcagaagaggtaccatcagaggaaatgccc
attagtgcccctgtggttcctaagaaacctgatgtgaaggatgaggaagaacaaataact
gaggcagaaaaggtaccaaaagtgcctcaaaaagctgatgaggtatctgaagaggttcca
tctgaggaaatagccataagtacccctgatgttcctctgaaacctgatgtgaaggaagtg
gaagaacaaatcgcagaggcagaaaaggtaccaaaagtggctcaaaaagctgatgaggta
tctgaagaggtttcatcagaggaaatgaccattagtgcccttgaggctcctcagaaacct
aatgagatggaagagaaagaacaaatagcagaggcagaaaaggtactgaaagtgcctcaa
aaagctgatgaggtatctgaagaggtaccattagaggaaatggccatttgtgcccttgag
gttcctcagaaacctgatgtaaaagaagaggaagaacaaatcacagaggcagaaaaggta
ccgaaagtgcttcaaaaagctgatgaggtatctcaagaggttccatcagaggaaatggcc
attagtgatgttaaggaagaggaagaacaaataactgaggcagagaagaaaccagcagag
atgcataaagttcaggaggtatctgaagaggtgccctctgaggaatatgctgtaactgct
cctgacatatctaaaaagcatgaaattattataaaggaggaagagatttcagaagttaaa
agagtccctgaggtgcctctgagggtagaaacagtttcagaagacataccacatgaagac
attgttgaaactgcaccagaagttcctgaaaaaccagaggtgacccgagaagaaataaca
atcatgcctgaagctgaaacatttggcaaggcaccttatgaagaaataacatttattgtg
ccagaattgccccaaaagccagtttcagatggtacaaaggtccctgaagctgctagaaga
ccagaaatggcacaagaagtggctgatcttccagaagagagatttctcaaaggggatgag
tttgaagtctcagtacccaaagaagagaaaccagaagaagtggaagcccagtttaagatt
cctgctgaagaaaaacctgaagatgtccaagccgaaattaaaattcctaagaaagagaaa
tctccggaacaagaactctcagagaaggagagactggtggtcaaagatgaagagaaagaa
gttgcagaagagaaggagttagctgaaatcactgaagaaaccaaagacattgagagtaca
agactctatgtggctgtagctaactatgaagcagaatcagatgaagttatgtccctccac
cagggtgagctagttgaggtccttgacagcagcagggacacctggtggctagccagaaaa
caagtggacaaaaaggagggttgggccccagctatgtatttgcaagccaaacctgactat
gatgagagaatcaaacagcaacttactaagaaaattgatgagatacctgttgaaacagct
gaagaattcacgggagatcttgtagcaccatattttgtgacccaattagaaaccatgcgt
gtgaaggatggtgctgtggctcgcttcgagtgccagattgaagggtctcccagacccaca
gttgtttggtacagggaaagcactgagatcaagccatctgatgacttcaagctccttcat
gaagaggacaggtgttccctgattattaaagagactttccctgaagatgctggaagatac
actgtggttgctaagaatgttgctggtgttgtccaacaaactacagaactcttcattgac
actccactttctggcagaacatccccatccagaagcagtgtttctagagaatccactgcc
ggttctgaagctgactatgtggctccatccattacacagaaacccaaattccagacagtt
aatgaaggcgagactgtcacatttgagtgtagattggtggcagtccctactccagagatc
acctggtttatcaatgaccagccattagacctagaggacactcgctacaggctgactgta
agaagtgatgtccacatgtacactgcagctctcactatacgagatgtcacactcaatgat
gctggcacatacaaaattgttggaagcaatgatgagggtgaaactggggttgcagtttcc
ctcattgtcaacaaagtaaaagatgaaaagaaagacttccgtgaccagctagaacacaaa
gagggcgtcgagctgaaggtggctccagaggagatagctacgcctgaagctgaacagtta
gatttcagaggacaactcaagactgaagtgaaaacaaaggttggagtcaaatatgaagtg
gagcaacttgatttcaggtccctgctcaaaaaagcatcagttaaatcaaagaaattcgag
actgacctggtccctaccgaagaggtccagcctgaggagaaaccagaggctgaccaggtg
gacttcagggcagttctcaaacctgctgaacaggaggctgtggaggaagagacacctacc
attaaagccccagaattcctcattcccctctctgacttaaaggtcaatgagggtcagcaa
gcccgcctggactgccaagtgataggcaacccacctcctgatatagtttggtaccacgag
gaggaagcaattgaggaaggggacgtctaccagctggaatggggtgaggagggtgcatat
tctctgatcctcaatgaggctttccccgaggactctggagaatacactatcaaggccatc
aatgagctgggccagacaaggtctactgctgtgctcactgtagaagccctgtttgtagat
gaaaagcctgcagctccagcagaacagattgaggaaatccctcagggtcctgaagctgaa
gaagcagctgtaaagattcaggcagcctttagaggccacttggccagagaggaagtgaaa
catttgaaggaagaacaggagcaggtcactgcagagattgagcttcctagtgcaccaaag
gaagaggaagcagaatttgtcttgaggccagaagataagccagaggatgttgaggctgaa
ctcaaagtgccggaggaacagcaagaagaggtggaacaggaatttgttcttcagaagcct
gaggaagaagaggtaccagttgaagtcacagttcctgtagaagcccctgtaattgtggag
aaacccgaggaacaggaagtgacagagggtaccactgtggagattgtctgcaaggtgaaa
ggtcaacccaaaccagagattaaatggcttcaagatgattcagagatccagcccagtgag
catttcaccatgtcagtgcaggaagatggcactgcctctctcaccattgtggaagctacc
ttggatgatgatgctgaatacacctgtgtagccaccaatgaggctggtaccacacaggcc
aagactgagctgtttgtcaatcctttaggtgaaaagccttccttcccaagcaagcttgag
gatgtggaggtggatgtaggcagcaccattacactggagtgcacagtgcatggtgagccc
caacccaagattacatggctcaaggatggggtgaagatctccgagaaaaaatacaagtct
gagtttgacactgagactggtgtggcgagactgacaatcccagaatgctctcctgatgat
gagggtgacttcacagtcaaagccatcaatgatctgggcactgcaacctgcgcctctatg
gtcatcatcatgacagaggcaccagagtttgtccagccaatcgaagaccagaaagctgct
gtcaagaccacagcacgctttgagtgccgtgtgactggaaaaccagctccaactataagg
tggtttgctgggcaagtagagctagcagacaatcacaaattcaaaacaaaacaggaggat
gacatggccatcttagaaattcacaatgtgtcgctggacgatgctgacatgtcgtacact
gtcagagcatacaacgtggctggagaggcatccatgactgccaacctagcagtggaagaa
aaagaaaaagaagtagtggaagagaaacctgaaactggtgtagctccagagtttgttctc
accatcaaatcaaccaaggttacagaggggcaaacagcagacttcagctgcaaggtaaca
ggtgaacccaccccaaccttgcactgggtctacaatgataaggaactggaagatgagggc
cgattcatgatatttgaggaagaagagcaccatcacctggagatttacgatgtggtacca
gaggatgctggcaccatcaaggtcacagctgagaacacagctgggtcagcttcctgcact
gctactctagatgtagaagaaaaacccaaagatatacccactcctcccaagttcatcgtg
aacattcagaccacagatgccacagtgggagagcaggccagtctgaggtgccaggccaag
ggagtgcccacccctacactggtctggtacaaagatggacgtgaaattagacctggagat
aacaggtacactatctcctatgatgaagatagtaccaccaccttaatggtgatagaagtg
gtgagagatgtggctggtacatacacctgtgaggccaccaacaaggctggtaaagatacc
accacaggagaccttaatgtacatgaagtacctatccaggaagtcccagaggaggaagtg
gaggagatggttgctccagtaatagtgaagaaacctgatcagcttactgtcaatgaaaaa
gacagggctgagtttatatgtaaaatcactggcacccctgctccacaagtaacttggagc
aaaggagatgaagagctcacagacaccaacaaataccacatagaagagtatgaagatgtg
tactgttttgagatcaaccaagctataaaagaagacacaggggattatacttgtactgct
agaaatcctgctggagagacaacatgcaccatcccccttactgtcaaagctgtcccgagt
gaagagctagaagaagtgccacccaaggtccctgagaaggaggaagatctgtccaagtcg
ccattggtactcagacatgcagaacagaccaaagctccagagttctctcagactttacaa
gatgtgatcctaatggaaggagatcaacttgagctgcagtgtgcagtgagtggtgtacct
agaccagaggtggcatgggacagggctggcaagactcttgttcccaccaaagtaatgtcc
atctcacatgaagaggacatgtgcactctaaccatcagtgaggtcacagttgaccaggct
ggacagtacacatgcacagcagtcaactctgcaggcaaggccatatgtacatcagaggtc
agagtacaggagagaccagaggctcctgagtttgtgcgtccactggaaaagagagtggtc
aaagagggcaagcaggtcaagatggactgtgctgtgaagggaaaaccaacaccagagatc
acgtggttgctcaatgatacacccattgaagcttccaagagggttgtccttgacaaacgc
cccactgatgaagagactgttcttactatgacaattaatgaggcagtcctaaaggattct
gggacagtgtctgtcactgccgtcaaccctgctggagaagtgaagacatctgcagaattg
attgttgaagctgcagaaattg

DBGET integrated database retrieval system