KEGG   Lingula anatina: 106161740Help
Entry
106161740         CDS       T04921                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 14
  KO
K15261  poly [ADP-ribose] polymerase 10/14/15 [EC:2.4.2.30]
Organism
lak  Lingula anatina
Brite
KEGG Orthology (KO) [BR:lak00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106161740
Enzymes [BR:lak01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     106161740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP Macro WWE
Motif
Other DBs
NCBI-GeneID: 106161740
NCBI-ProteinID: XP_013394219
UniProt: A0A1S3I9Y7
Position
Unknown
AA seq 721 aa AA seqDB search
MSTGEMKKTDGFNLQCQKIYHVVCPDWGPAKEQTLSRLMSQCLEQAHQDGVSSIAFPALG
TGNLKFPKDVVADVMFKEALQFSAKNSQTKVKEIRFVLYPQDTQTITAFKMKLFEVQGRP
KTVHFRRRKGITMQLEKPNFMELSCNAVTVQVKQGNVMEDTVDIIVNTVDPQLNMGVLGK
HLVKAGGNDIKKELQTKKRHAQNGAVLDTTPGKLPFKRIYHVVIPPANQIHRSIQQCLLL
AEKFGFSSIAFPAIGTGKANLDPANCAKETLSGIFQTLQENNIESLKMICVTVYDQGQIP
IFIDEARAQSTVTGRTRKGRRQSMRQRQSLTALQRVVLDVYGASDKVAETDEDIAAFIKQ
NIQKETIELKGHTITQADIAEIRDLEVERGVTATIDTNTSTISIVGCPVDVSPTVSTIYK
IIHKKIEDRAEEDKAAALQQKIQWCWLAAKDQSREPFDKMTNYRVELAHRAREGSVVYEI
EGSPCKLDFSTMTETDCSNDIVTQVIREVKDPSLPSHWSPQPRDSDIPHAVHQVNIKAGD
QEFNKVAEQFNAAFDTDGVRRKKIVQLLRIQNPHLYKQYKTYSAKLERENQGMNNEMSLF
HGTSEANCDYISHQGFNRSFGGLNVGAIFGKGVYFAKKATYSAQPCYCKPNAAGEQFMFL
AKVLVGSYTKGHRKMLTPPPKDPDKPLETYNSVVDNTKTPTIFVIFYDAQAYPEYLIKFK
A
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactggggaaatgaagaagacggatggtttcaatctccaatgccaaaaaatctac
catgttgtctgtccggattggggacctgcaaaagaacagacgctgtccaggttaatgtca
cagtgtttagaacaagcacaccaggatggagtatcatctatagcatttcctgctcttgga
accgggaacctgaaatttcccaaagatgttgtggctgacgtcatgtttaaggaggccttg
caattcagtgcaaagaactcgcagaccaaagtcaaggagattcgatttgttctttatcct
caagatacacaaactatcactgcttttaagatgaaattgttcgaagtacagggacggccc
aaaactgtgcattttcgtcgtcgaaaaggcataacaatgcaattggaaaagcctaacttt
atggagctgtcttgtaatgcagtaactgtgcaagtcaagcagggcaatgttatggaagat
actgttgatattattgtgaatactgttgacccacaactcaatatgggggtgcttgggaag
catttggtaaaagctggaggtaacgatatcaagaaagaactacaaactaaaaagagacat
gcacagaatggggcggttctagatacaacccccggcaaacttccttttaagagaatttac
cacgtggttattccaccagccaatcagattcatcgaagcattcagcagtgcttacttttg
gctgagaaattcggattttcttcaatcgcttttcctgccataggaacaggtaaagctaac
ttggatccagcgaattgtgccaaagagacactgagtggtatatttcagaccctccaggaa
aataacattgaaagtttgaagatgatttgtgttacggtttacgaccaggggcaaattccg
atttttatagacgaagcaagagctcagagtacagttacaggcagaacaagaaaaggtcgt
cgccaatccatgcgccaacgccaaagccttacagctttacaaagagtggtacttgatgta
tatggagccagcgataaagttgccgaaacagacgaggacattgcagcttttattaaacag
aacatccaaaaggaaaccattgagttgaagggacatacaattacacaagctgacatagca
gaaatacgagaccttgaggttgaacgaggagtaacagccaccatagatacaaatacgtca
acaatatcgattgtgggatgtcctgtggatgtttctccgactgtcagcactatctacaaa
ataatccataagaagatagaagacagagcagaggaggacaaagctgcagcactccagcag
aaaattcagtggtgttggttagctgctaaagatcagagtagggagccttttgataaaatg
acaaactatcgtgtggaattggctcacagagcaagggaagggtcagtggtgtacgagata
gaaggcagtccttgtaagttggattttagcactatgacagagacggattgcagtaatgac
attgttacccaggttatacgagaagtcaaagatccttccttaccttctcattggtcacct
caaccacgtgacagtgatatcccgcatgctgtgcatcaagtgaatataaaagctggggac
caggagttcaacaaagtggccgagcagttcaacgccgcctttgacactgacggtgtgcga
agaaagaaaatcgttcaactgctgagaatccagaacccacatttatataagcagtataag
acatacagtgctaaactggagcgtgagaaccaagggatgaacaatgagatgtcacttttt
catggaacgtcagaagctaattgcgattacataagccaccaagggtttaacagaagcttt
ggtggattaaacgttggcgccatctttggaaaaggggtatactttgccaaaaaagccacc
tattctgcccagccctgttactgcaagcctaatgcagccggggagcagtttatgttcctg
gccaaggtacttgttggatcctacacaaagggacaccgcaagatgctgactcctccccct
aaagatcctgataaaccactggagacatacaactctgtggtagacaatacaaaaacaccg
accatttttgtgatattttatgacgcgcaagcctatcccgaatatctaattaagttcaag
gcatag

DBGET integrated database retrieval system