KEGG   Lingula anatina: 106162865Help
Entry
106162865         CDS       T04921                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
lak  Lingula anatina
Pathway
lak00350  Tyrosine metabolism
lak00360  Phenylalanine metabolism
lak00380  Tryptophan metabolism
lak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106162865
   00360 Phenylalanine metabolism
    106162865
   00380 Tryptophan metabolism
    106162865
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lak04147]
    106162865
Enzymes [BR:lak01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     106162865
    4.1.1.105  L-tryptophan decarboxylase
     106162865
Exosome [BR:lak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106162865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 106162865
NCBI-ProteinID: XP_013395748
UniProt: A0A1S3IC50
Position
Unknown
AA seq 477 aa AA seqDB search
MDAAEFRQRGKEMVDTVADYLENIQKRPVFPSVQPGYIRELVPESAPETAESWEDLFGDI
ERVVMPGVTHWHHPQFHAYFPTANSYAALCADMLSDAIGCIGFSWASSPACTELEMVMMD
WLGKMLDLPQEFLFCSGGKGGGVIQGTASEATLVALLAARNQTIHREKEANPALTEADIM
ARMVGYCSDQAHSSVERAGLLGAVKIVKLSSDRKQSLRGETLAQAVQKDKEKGLIPFFVC
GTLGTTPSCAFDSIEELGAVCNLEKIWLHIDAAYAGSAFICPEFRYLLSGVQFADSFNFN
PHKWLRVTFDCSAMWIKDSSKLVDAFNVDPLYLKHDNQGKVPDYRHWQIPLGRRFRSLKL
WFVLRLHGIKGLQEYIRQHVKLAHEFEALVLADERFEIVAEVVLGLVCFRLKGANDINEQ
LLQRINQDGRIHLVPSKIGNTYFLRFAVCAPYAESKDVQFAWTVLTELATELLKEKK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgccgaattccgtcaacgagggaaagaaatggtggacactgtggcggattac
ttggaaaacatacaaaaacggccagtgtttccatccgtgcagcctgggtatattcgtgaa
ctagttccggaatctgccccagaaactgcagagtcatgggaggatttgtttggagacatt
gagcgggtagttatgcctggggtaacacactggcaccacccccagttccatgcatatttc
ccaactgccaactcttatgctgccttgtgtgctgatatgctgtcagatgcaataggttgt
atagggtttagctgggcatcaagtcctgcctgcacagagctggagatggtgatgatggac
tggctggggaagatgttggacttgcctcaggagttcctcttctgttctggagggaaaggg
ggtggggtcatccagggtactgctagtgaagccactctggttgccctgttagctgccagg
aatcaaaccatccacagagagaaggaagccaacccagcactgacagaggcagacatcatg
gccagaatggtgggctactgctctgatcaggcccattcttcagtggagcgtgctggtttg
ttgggtgcagtaaaaatagtcaaactttcctctgacaggaagcagtcattacgaggagag
acattagcccaggctgtacaaaaagataaggaaaagggcttgatacctttctttgtgtgt
ggcactttggggaccacaccctcttgtgcctttgacagcatcgaggagctgggggcagtg
tgtaacttagagaagatttggctccacattgatgctgcgtatgctggcagtgccttcatt
tgtcctgaatttcgataccttctcagtggagtgcagtttgcagattcatttaacttcaat
cctcacaaatggctgcgggtgacctttgactgctcagcaatgtggataaaagatagcagc
aagctggttgatgcattcaatgtggatcctctatatctaaaacatgacaaccagggaaag
gtaccagactacaggcactggcagattccactaggaagaagattccgttctctgaaactg
tggtttgtcctccgactacatgggatcaagggactgcaggagtatatcagacagcatgta
aaactggcacatgaatttgaggcactggtcttggcagatgagaggtttgagattgttgct
gaagttgtcctggggttggtgtgctttagactgaagggagccaatgacattaatgaacag
ctgcttcaaagaataaaccaggatggcaggattcacctggttccatctaaaatagggaat
acatacttcctgcgttttgcagtgtgtgcaccatatgcagagtccaaagacgtgcagttt
gcctggactgttttaacagaattagctacagaattgttgaaagagaaaaagtaa

DBGET integrated database retrieval system