KEGG   Lingula anatina: 106167191Help
Entry
106167191         CDS       T04921                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
lak  Lingula anatina
Brite
KEGG Orthology (KO) [BR:lak00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lak01002]
    106167191
Enzymes [BR:lak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106167191
Peptidases [BR:lak01002]
 Serine Peptidases
  Family S33
   106167191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 106167191
NCBI-ProteinID: XP_013401370
UniProt: A0A1S3IT32
Position
Unknown
AA seq 179 aa AA seqDB search
MGGAIVGNYAAMYPEDVATVTLLCPLMKTPIPSTMIADAKAGRTTALQDAFSPEAVQFML
DQCSVEKRQYPRVLLEGIAELRRRHEAFFSKLYFALGKHENRTALETSLPKIAVPVHVLW
GDQDQIVHVSGTEVIERVSPRSRITILKNKGHSLNLECPQIVVDSVLDSTRVTIPKSSL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgggcggagctatagttgggaactacgccgccatgtacccggaagatgtcgccactgtc
accttactgtgtccattgatgaagacgccgattcccagcaccatgattgcggacgccaag
gctgggaggaccacggccttacaagacgccttcagtccagaggcggtccagtttatgctt
gaccagtgttccgtggaaaaacgtcaatatccacgcgtgctcttggaaggcatagcagag
ttgagaaggcggcatgaagcttttttcagcaaattgtattttgcgctggggaagcatgag
aaccggacagcactggagacctcacttcccaagatagcggtccccgttcacgtgctttgg
ggtgaccaagaccagatcgttcacgtctcagggacggaagtcatagaaagggtgtcgccc
aggagcaggataacgatattaaagaacaagggtcactctttaaacctggaatgtccgcag
attgtagtggacagcgttctggactctacacgtgtcacgataccaaagtcttccctataa

DBGET integrated database retrieval system