KEGG   Lingula anatina: 106167245Help
Entry
106167245         CDS       T04921                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
lak  Lingula anatina
Pathway
lak00071  Fatty acid degradation
lak01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106167245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lak03029]
    106167245
Enzymes [BR:lak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     106167245
Mitochondrial biogenesis [BR:lak03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    106167245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128 Ribosomal_L6e
Motif
Other DBs
NCBI-GeneID: 106167245
NCBI-ProteinID: XP_013401422
UniProt: A0A1S3IT97
Position
Unknown
AA seq 852 aa AA seqDB search
MKYVNALDLLWHYKCPLISVTENSVHHKSLIGLLNPKKKNEISKPRPHLDLRGEDAVSCF
VIRSDKMAEAHAAVAFSFTITHEGVNFDVNHDALHAVWESGVRSWKKRIARFKNRLINIM
YPAAPISWVFTVSIVLAFVLAKVDVSLGLIDSIQSGMPGVRALSYPYKFYASAVVFGTLV
WLLKIFVLRYLLKLLLMYHGWMFEPRGKVSIWTKLWSVLVRLLGGRKPLLYSYQASLPKM
FVPRVEDTMERYIKSVRPLMDDANYERMKTLSEEFKNGVGKKLQRYLLLKSWWATNYVSD
WWEEYVYLRGRSPIMVNSNYYGVGAVFHHPTKIQAARAANVTYAFLKFRREIEREELSPI
LLNGTVPLCSQQYERQFNSVRLPGVETDKLVHWYDSRHIVVYHKGCYYKMYIHYKGRLLN
PAELELSFKKIIEDNHEPAKGEEKLGALTAGDRIPWAKARKEYFGKGVNKTSLDSIEKSA
FVVVLDDEPRYIDLNEPNKLSSWARAMLHGKGYDRWFDKTFNLIISANGRIGFNAEHSWA
DAPIMAHLWEYGISEDIAHLGADAPIMAHLWETTMAIDTETGYTETGHCKGEASIQPPNP
IRLQWEIPDECCAVIDNSLRVSQALANDVDLHLEVHTQFGKGLIKKCKTSPDAFIQMALQ
LAYFRDAGKFCLTYEASMTRLFREGRTETVRSCTIDAANFARAMDDKTKTKAEKMALFKK
ASETHQESYRLAMTGNGIDRHLFCLYVVSKYLEIESPFLKEVLGEPWRLSTSQTPHTQTD
RLDLLKHPDHICAGGGFGPVADDGYGVSYIIAGEYTIFFHVSCKRSCAETNAKRFGRTIV
KALDDLKNLFEV
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgtaaacgctttagatttactctggcactacaaatgtccattgatttcggtt
actgaaaattctgtgcaccacaaaagtttaattgggttactaaatcccaaaaaaaagaac
gagatttccaaaccgaggcctcacctggatctgagaggtgaagacgctgtcagctgtttt
gttatcagatctgacaagatggcagaggcacatgctgctgtggctttttcttttactatc
actcatgagggagtcaacttcgatgtgaaccatgatgccctccatgctgtatgggagagt
ggggttcgatcatggaagaaaaggattgccagattcaagaaccgcctcatcaacatcatg
tatccagcagcccccataagttgggtgtttactgtcagcattgtcctggcttttgttctg
gccaaggtggatgtttctctggggcttatagatagtatccagagtggaatgcctggtgta
agagctctcagctatccgtacaaattttatgcaagtgcagttgtgtttgggactttggtc
tggcttctcaaaatatttgtgttgaggtatctgctgaaactcctcctgatgtaccacgga
tggatgtttgaaccaagaggaaaagtgtcaatatggacaaagctgtggtcggtcttagtg
cgcctgctgggaggcaggaaaccactgctgtacagttatcaagcttctttaccgaagatg
tttgttcccagagtggaggataccatggaaagatatattaagtctgtccgcccacttatg
gacgatgctaattatgagagaatgaaaaccctctctgaagaattcaaaaatggtgtgggt
aagaagttgcagaggtaccttctcctgaaatcctggtgggccaccaattatgtgtctgat
tggtgggaagagtatgtctacctcaggggaagatcccccatcatggtcaacagcaactac
tatggtgtgggtgctgttttccaccatcccaccaagatacaggctgccagagctgccaat
gtcacatatgctttcctgaaatttaggagagagattgagagagaagagttgtccccaatc
ctgctgaatggtactgtacccctgtgctcccagcagtatgaaagacagttcaactctgtt
agattgcctggtgtggaaacagacaagttggttcattggtacgactctcgccacatagtg
gtctaccacaagggctgttactacaaaatgtatatccattacaagggcagactgcttaat
cctgctgagttggaattgagctttaaaaagataattgaagataatcatgagcctgctaaa
ggtgaagaaaaacttggagccctaactgctggagacagaattccatgggcaaaagcaagg
aaagaatactttggaaagggtgttaataagacttctttggattctattgaaaagtctgca
tttgtggtagtgttggatgatgaaccaagatacattgatctgaatgagcccaataagttg
agttcttgggcccgtgccatgctgcatggaaaaggctatgacagatggtttgataagact
ttcaatcttatcatcagtgctaatggcagaattggattcaatgctgaacattcttgggct
gatgcaccaatcatggctcatctgtgggaatatggaataagtgaagatatagctcattta
ggggctgatgcccccataatggctcatctgtgggagactactatggctatagatacagaa
actggatacacagagacaggccactgcaagggagaggctagtatacagccacccaaccct
attcgtctgcagtgggagatcccagatgagtgctgcgctgtgatagacaatagcctgcgt
gtttcccaggctcttgccaatgatgtagatcttcacctggaagttcatacacagtttgga
aaaggactgatcaagaagtgcaagaccagccctgatgcatttatacagatggctctacag
ttagcttactttagagatgctggaaaattttgcttgacctatgaagcctcaatgaccaga
ctgttcagggagggtaggacagaaactgtccgctcctgcacaatagatgctgccaacttt
gccagagccatggatgacaaaaccaaaacaaaagctgaaaagatggccctgttcaaaaag
gcatcagagactcatcaggaatcataccgcctggccatgactggcaatggcatcgacagg
cacttgttctgtctatatgtggtttcaaagtacctcgagattgaatctccattcctgaaa
gaagtgctaggggaaccatggaggctgtccactagccagacaccgcacacccagacagac
agattggatttgttgaaacacccagaccatatttgtgcaggaggtggctttgggccagtt
gctgatgacggttatggtgtgtcttacattattgctggagagtacacaatcttcttccac
gtctcctgcaagagatcctgcgcagagactaacgcaaaaagatttggtcggaccatagtg
aaggccctggatgatttgaagaatttgtttgaagtgtga

DBGET integrated database retrieval system