KEGG   Lingula anatina: 106167616Help
Entry
106167616         CDS       T04921                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
lak  Lingula anatina
Brite
KEGG Orthology (KO) [BR:lak00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lak01002]
    106167616
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lak04147]
    106167616
Enzymes [BR:lak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106167616
Peptidases [BR:lak01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   106167616
Exosome [BR:lak04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   106167616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_3 Abhydrolase_6 Thioesterase Abhydrolase_2 Peptidase_S15 Peptidase_S9 DUF3089 Lipase_3
Motif
Other DBs
NCBI-GeneID: 106167616
NCBI-ProteinID: XP_013401900
UniProt: A0A1S3IUL7
Position
Unknown
AA seq 379 aa AA seqDB search
MQLRSGSKTKEKANMKKKSTKKLDTRNVSKKKREEDITCSQRSWSNKCLKTVGVMLFIIY
VLIPVIVKTNSWIMSRVVFLPMFRPDMFKDVSKPEMYGLNSTRNFYIEDNGVKLGAWHVL
PQSLAKEVGNEKQHITSLQDGKPIILYLHGQSGTRGSGHRIPLYAVLSSLELHVIAVDYR
GYADSEGPFPCEPGLIRDGKAAYKWIKERSKNTPIFLWGHSLGAGVATQLAKELCSEGRA
PKGMILESPFNNLREAASSHPLGLLWWFLPMFEWIFINPIEENDIHFQNDEHISAVTCPI
MILHAEDDYMVPYELGVKLYKKAVSSKEKGAGAVKLVSFDKSEGLGHRDIYKSSNLPATL
RQFIAETSGQKANSGQSED
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaagaagtggttcaaaaacaaaagaaaaagcaaacatgaagaaaaaaagcaca
aagaagcttgatacgagaaatgtttcgaagaaaaagagagaagaggacattacttgcagt
cagaggtcttggtcaaacaagtgtctgaaaactgttggagtgatgctatttattatttat
gtactgatacctgtgatagtgaagaccaatagctggataatgagcagagttgtgttttta
ccaatgtttaggcctgatatgttcaaagatgtcagcaaacctgagatgtatggtttaaac
tcaactaggaatttctatattgaagacaatggtgttaagttgggtgcttggcatgttttg
ccacagtctttagctaaagaagtagggaacgaaaaacagcatataacttcccttcaggat
ggaaaacctattattttatatttacatggacaatctggtacaaggggctcaggacatcgc
attccattgtatgcagtgctatcttcattagagcttcatgttatagctgtggactatagg
ggttatgcagattctgaaggcccatttccttgtgagcctggtttgataagagatggtaaa
gctgcctacaagtggataaaagagagatcaaaaaacacacctatctttttgtggggacat
tccctgggagctggggttgctacgcagctagccaaggaactgtgcagtgaaggcagagct
ccaaagggtatgatcttggaatcccctttcaataatctccgtgaggcagcaagcagccat
cccttaggcttactgtggtggtttttacccatgtttgagtggatattcatcaatccaatt
gaagaaaatgacattcacttccagaatgatgagcacatttctgctgtgacatgtcccatc
atgattctccatgcagaggatgattacatggtgccttatgaactgggagtgaagttgtac
aagaaggccgtttcctcaaaagaaaaaggtgcaggtgcagtgaagctggtttcttttgat
aaatccgagggtcttggacaccgtgatatatacaagtcttccaatttaccagctactttg
agacaattcattgcagaaacttcaggacagaaggcaaactcgggtcaatcagaagattga

DBGET integrated database retrieval system