KEGG   Lingula anatina: 106169198Help
Entry
106169198         CDS       T04921                                 

Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial isoform X1
  KO
K00139  succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
lak  Lingula anatina
Pathway
lak00250  Alanine, aspartate and glutamate metabolism
lak00650  Butanoate metabolism
lak01100  Metabolic pathways
Module
lak_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106169198
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106169198
Enzymes [BR:lak01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     106169198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 106169198
NCBI-ProteinID: XP_013404047
UniProt: A0A1S3J0S8
Position
Unknown
AA seq 512 aa AA seqDB search
MLQVIKLLGSRSLLSRLQVSRMAYSVRTASQFLHEKAYVNGKWVDAKSGKTFQVLNPANG
GLMGSCPDMNAEDTQIAIQKAHTAFQSWKKSSVKERSAVLRKWFNLMMENQQELGKLITE
EMGKPLKEAMGEIGYAAGFFEWFAEEARRTYGDIIPSPVDSKRLLAIKQPVGVCGLITPW
NFPSAMITRKAGAAIAAGCTVVIKPAEDTPFSALVLCDLAEKAGLPPGVINVVTCSRQNT
VEVGKVLCESPLVAKISFTGSTNTGKILLQQCANTVKRVSMELGGNAPFVVFDSADVDAA
VMGAMACKFRVSGQTCVCANRFLVQEGIHDQFVQKLGEQMLKQLKVGDGFSEDVTQGPLI
NSKGVDKVDELTQDAVSRGAQLKMGGKRHSAGENYYEPTLLTDVTSEMRCFKEEIFGPVS
AVIKFRTEEEAVALANASSVGLAGYFFSRDLSQIWRVAENMEVGMVAVNDGILSTVEAPF
GGVKESGIGREGSKYGIDEYMNIKYICMGGIQ
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaggttatcaagctgctgggcagtaggtccctcctgtccagattacaggtgtcc
agaatggcatactctgtcaggacggccagtcaattcctccacgagaaggcctacgttaac
gggaagtgggtggacgccaaaagtgggaaaacgtttcaagtgttgaacccagctaatggg
ggtctgatgggaagttgtcctgacatgaatgcagaagacacgcagattgccatccagaag
gcacacacagcttttcagtcctggaagaagtcctctgtcaaggaacgcagtgctgtactg
agaaaatggttcaatcttatgatggagaaccagcaagaactgggaaaactcatcacagag
gaaatgggcaagccactgaaggaagctatgggggagataggctatgcagccgggttcttt
gagtggtttgcagaagaagcaagacgcacatatggtgacataattccgtccccagtggac
agcaaacgccttctggccatcaaacaaccagtgggcgtgtgtgggttgattacaccatgg
aatttcccatcagctatgataacacgtaaagctggagctgccattgctgcagggtgtact
gtggtcattaaaccagcagaagatacgccgttttctgcactcgttttgtgtgatttggca
gagaaggcaggcttgccaccaggtgtcataaatgttgtcacctgttcaagacagaacaca
gtggaagttgggaaggtgctatgtgagagccctctggtggcaaaaatatcatttacaggt
tctactaacactgggaagattctcttgcagcagtgtgccaacacagtaaagcgagtgtcc
atggagctgggtggcaacgctccctttgtggtctttgacagtgcagatgtggacgcagct
gtgatgggagcaatggcctgcaagttcagagttagtggtcagacgtgtgtgtgtgccaac
aggttcttggtgcaggagggaatccatgaccagtttgtacagaagcttggggagcagatg
ctgaaacagctgaaagtgggggatgggttctccgaggacgtcacacaaggcccactgatt
aatagtaaaggtgtagacaaggtagatgagctgacccaggatgctgtgtcaagaggagct
cagttgaagatgggcgggaagcgacactcagctggcgagaactactacgagcctacgctc
ctcactgatgtcacgtcagaaatgaggtgttttaaagaggaaatctttggtcctgtgtca
gccgtaattaaatttagaactgaagaggaagccgtagcactagcaaatgcaagctccgtt
ggcttggcaggttactttttctccagagatttgtctcaaatttggcgcgtggctgagaat
atggaggttggcatggttgccgttaatgacggcatactgtctacagtggaggcccctttt
ggtggcgtcaaggagtccgggattgggagagaaggctccaaatatgggattgatgaatac
atgaatattaagtacatttgtatgggtgggattcaatag

DBGET integrated database retrieval system