KEGG   Lingula anatina: 106169841Help
Entry
106169841         CDS       T04921                                 

Definition
(RefSeq) mitochondrial enolase superfamily member 1 isoform X1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
lak  Lingula anatina
Pathway
lak00051  Fructose and mannose metabolism
lak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106169841
Enzymes [BR:lak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     106169841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C DUF3025 HTH_6
Motif
Other DBs
NCBI-GeneID: 106169841
NCBI-ProteinID: XP_013404925
UniProt: A0A1S3J3E9
Position
Unknown
AA seq 442 aa AA seqDB search
MATITELTVKDVRFPTSLEAHGSDAMHADPDYSCAYVIFKTDSKLEGHGLTFSLGRGNDL
VCNSIKYMGRMVVGKKVSDIFDNFGIFWEKLVNDTQFRWLGPEKGVVHLATAGIVNALWD
MWAKMEGKPLWKLLVDMEPEKLVSTMDFRYLSDALTPEEALAILKKNQSTKAEREKELLS
KGYPAYTTSAGWLGYSEERIKKLCQEAMAEGFTKFKVKVGADLKDDIRRCRVIREQIGYD
KVLMTDANQRWDVQQSIDWMKQLAEFKPLWIEEPTSPDDIMGHAAIAKALKPYGIGVATG
EMCQNRVMFKQFIVEGAMQFCQIDSCRLGGVNEILVVLLMAYKYRVPVCPHGGGVGLCEY
INHLCIFDYICVSASMENRVTEYVDHLHEHFKSPCVVKDGCYTVPKDPGYSAEMKEESLL
EYEYPSGSVWKKLFAEGKFTPE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggccacaataacagagctgactgtgaaggatgttcgctttccaacttcattggaggcg
catggttcggatgccatgcatgcagacccagactactcatgcgcctatgttatattcaaa
acagactccaaacttgaagggcatggattgactttttctcttggaagaggcaatgacttg
gtgtgtaattccataaaatacatgggcagaatggtagttgggaagaaggtgtcagacata
tttgacaattttggtatcttttgggagaagctggtgaatgacacacaattccgatggctt
ggcccagagaagggtgtggttcatctggcgacagcagggattgttaatgcattgtgggat
atgtgggccaagatggagggaaagccattgtggaaacttttagttgatatggaaccagaa
aagttagtgtccacaatggacttcagatatctgtcagatgctctcacaccagaggaagca
ttagcaatactgaagaaaaatcagtctaccaaagcggaaagagagaaggagttgttatca
aagggataccctgcatataccacctctgctggctggttgggttacagtgaagagaggata
aaaaagttgtgtcaagaagccatggcagaaggatttacaaaattcaaggtgaaagttggt
gctgacctaaaggatgacataagaagatgtagagtgatcagggaacagataggatatgac
aaggtcttgatgacagatgctaaccagcgctgggatgtgcaacagtctatagattggatg
aaacaattggctgagttcaagcctttgtggattgaggaacccactagtcctgatgacatt
atgggacatgctgctattgctaaagcattgaagccttatggtattggagtggcaacagga
gaaatgtgtcagaaccgtgtcatgttcaaacagtttatcgtggaaggtgccatgcagttt
tgccagattgacagctgtcgtctgggaggagtcaatgagatcttggtggttttgttgatg
gcttacaagtatagagtaccagtatgcccgcatggtggaggagtaggcttgtgtgaatat
atcaaccatctatgcatctttgactacatctgtgtgtcagcttccatggaaaacagagtg
acagaatatgtggaccatcttcatgagcactttaaatctccatgtgtagttaaagatggg
tgttacacagtccctaaggatccaggttacagtgcagagatgaaagaggaatccttgttg
gagtatgaatatcccagtggaagtgtgtggaagaaattgtttgcagaggggaagttcaca
ccagaatga

DBGET integrated database retrieval system