KEGG   Lingula anatina: 106171088Help
Entry
106171088         CDS       T04921                                 

Definition
(RefSeq) pyruvate carboxylase, mitochondrial
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
lak  Lingula anatina
Pathway
lak00020  Citrate cycle (TCA cycle)
lak00620  Pyruvate metabolism
lak01100  Metabolic pathways
lak01200  Carbon metabolism
lak01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106171088
   00620 Pyruvate metabolism
    106171088
Enzymes [BR:lak01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     106171088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 Dala_Dala_lig_C ATP-grasp_3 HlyD_D23 HlyD_3 RimK NQRA ATPgrasp_ST RnfC_N DUF2118 GCV_H
Motif
Other DBs
NCBI-GeneID: 106171088
NCBI-ProteinID: XP_013406677
UniProt: A0A1S3J8E9
Position
Unknown
AA seq 1205 aa AA seqDB search
MLRLQARTAQIRVAASTQLTPLAGRVKPKHGYALPQGLARAYSTPIPNQRPEVQPIEKLM
VANRGEIAIRVFRACHEMKIRTVAVYSEQDTMHIHRQKADEAYLIGKGLPPVASYLNIPE
IIQVAKENNVDAIHPGYGFLSERADFAKACEVNDIKFVGPPSEIVRKMGDKVEARQAAID
AGVQVVPGTAQAIQTAEEALEFCHIHGCPVIFKAAYGGGGRGMRMVRDIKDVEESFNRAR
SEAEAAFGDGSLFLEKFIERPRHIEVQILGDKDGNVIHLYERDCSVQRRHQKVVEIAPAP
WLNSEIRNKMTADAVKLAQYVGYENAGTVEFLLDQHGNYYFIEVNARLQVEHTVTEEVTG
LDLVQSQIRIAEGFLLPELKMKQEDIVLNGSSIQCRMTTEDPAKGFQPDTGRIEVFRSGE
GMGIRLDSALAYAGAIISPYYDSLLVKVISHARTHQDACAKMVRALTEFRIRGVKTNTPF
LLNVLQNTKFLEGAVDTYFIDEHPDLFKLKPSQNRAQKLLRYLADVMVNGPLTPLATGLQ
PAEIVPTVPHVPFGTTTTQDVKHPKGWKNVLDKEGPSGLAKAIRNHKGLLLMDTTYRDAH
QSLLATRVRTYDMKRISPYTSHHLSNLFALENWGGATFDVAMRFLHECPWERLEELRQLI
PNIPFQMLLRGANAVGYTSYPDNVVYKFCDLAVQCGMDIFRVFDSLNYVPNLILGMEASA
KAGGVVEAAICYTGDVTKPGTKYDLDYYLTLADDLVKGGTHILGIKDMAGLLKPNASKLL
IGSLRERFPDMPIHVHTHDTAGAGVASMLAAAQAGADIVDVAVDSLSGLTSQPSMGAIVA
AVENTELDTGIKLDNVFDYSAYWAQARQLYAPFECCTTLKSSNADVYLNEIPGGQYTNIQ
FQAYSLGLADQFEEVKKKYAEANQLLGDIIKVTPSSKVVGDLAQFMVQNKLTGQMVKDRA
EELAFPNSVIQYLQGYIGEPPFGFPEPLRSKVLKDKPRIKGRPGESLPDMDFDQLHSQLV
ERHGKNVTDKEVMSAALYPKVTEEYLEFKETYGPVQRLESKLFFTGPLIGQEIQVEIEKG
KTLHIKTLAVSEKLTKTGEREVFFELNGQLRSVLVKDLEAMKEMHFHPKALKGVKGSIGS
PMPGNVVDIKVKEGDRVKQGDTLLVLSAMKMEMTVTAPIDGIVKKVAVTKDMKLEGDDLL
MEIEA
NT seq 3618 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcctgcaagctcgcactgctcagatccgtgtggctgcctccacacagttgacc
ccactggctggacgggtcaaaccaaaacatgggtatgccttgccccaggggcttgccagg
gcctactctacccccatacccaaccagaggccagaggtacaacccatagagaagttgatg
gtggctaatagaggtgagattgccatccgtgtcttcagagcctgtcatgagatgaagatt
cgcacagtggctgtctactcggagcaagatacgatgcacattcacagacagaaggcggac
gaggcatacctcatagggaaaggtcttccacctgtggcatcctatctgaacatacctgaa
ataatacaggttgccaaggaaaacaatgtagatgctatccatccaggctatgggttcctc
tcagagagggcagattttgctaaagcttgtgaagtaaatgacatcaagtttgttggacca
ccttcagaaattgtgaggaagatgggagacaaagtggaggctaggcaggctgccattgat
gcaggcgttcaggtagtccctggcacagctcaggcaatccagactgctgaggaagccctg
gagttctgtcatatccatggctgtcctgtgatcttcaaggcagcttatggagggggaggc
agaggaatgaggatggtcagagatatcaaagatgtggaagaaagctttaaccgtgcaaga
tcagaggcagaggctgcttttggagatggctcactgtttttagaaaagttcattgagaga
ccaagacatattgaagtgcaaattctaggggacaaagacggaaatgtaattcatctgtat
gagagagactgctcagtccagcgtaggcatcaaaaagttgtggagattgccccagctcca
tggctcaacagtgaaatccgtaacaagatgacagcagatgctgtaaaacttgctcaatat
gtgggttatgagaacgctggcactgtggaattcctactggatcagcatggaaattactac
ttcattgaggttaatgccagactgcaagtggaacatactgtgacggaagaagtcacaggg
ttggatttagtgcaatctcagatcaggatagctgaagggttcttgctgccggagctgaag
atgaagcaagaggacattgtgctcaatggaagctctatacagtgcagaatgaccactgaa
gatccagccaagggattccagccagacactggaagaattgaggttttccgcagtggagaa
ggcatgggtatcaggttagacagtgcacttgcctatgcgggggccatcatctctccatat
tatgactctctgctggtgaaggtgatttctcatgcacgcacccaccaagatgcatgtgcc
aagatggtacgtgctctgaccgagttcaggattagaggagttaagaccaacacaccgttc
ttgctcaatgtcctccaaaatacaaagttcctggaaggtgctgtggatacttacttcata
gatgaacatccagatctcttcaagctgaaacccagccagaaccgtgcgcagaagctgctc
cgctacctggccgatgtgatggtgaacggccccctcactccgctagcaactgggcttcag
cctgcagagattgtaccaactgtgccgcatgtgccttttggtacaacaacaacccaggat
gtcaagcatcccaaaggctggaagaatgttctagacaaagaaggacccagtggcttggca
aaagcaatcagaaatcacaaaggtcttctgcttatggacaccacgtacagggacgcccac
cagtccctactggctactagagttaggacttacgacatgaagagaatctctccgtacact
tctcaccatctcagcaatttgtttgctttagagaactggggaggtgccacatttgatgtg
gctatgaggtttcttcatgaatgtccatgggaacggctggaagagctgcgacagcttatc
cctaatatccccttccagatgctactacgaggtgctaatgctgtgggctataccagctac
ccagataatgtggtttacaagttttgcgatcttgctgttcagtgtggcatggacatattc
agagtgtttgattctctgaactatgttcccaatttaattcttggcatggaagcttcagca
aaagcaggtggagtggtggaggcagccatatgctatacaggagatgtcactaaacctgga
actaagtatgatctggattactacctgaccttggcagatgacctggtcaagggagggaca
catattctaggaataaaggacatggcaggtcttctcaagccaaatgcatcaaagcttttg
attggctccctgagagagagattcccagacatgcccatccatgttcacacacatgacact
gcaggtgctggtgtggcatccatgttggcagctgcacaagcaggagctgatatcgttgat
gtggctgtggattctctctcaggactaacttctcagccgagcatgggtgcaattgtggct
gctgtggaaaatacagaattggatactggtataaaactggataatgtgtttgactactct
gcgtactgggctcaggccaggcagctgtatgctccatttgaatgctgtacaactctgaag
agctcaaatgctgatgtctacttgaatgagatcccaggaggccagtacaccaatattcag
ttccaggcctacagccttggactagctgaccagtttgaggaggtgaagaaaaaatatgct
gaggccaaccagcttttaggagacataatcaaggtgactccatcctctaaggttgtggga
gatttagctcagtttatggtgcagaataagcttaccgggcagatggtaaaggacagagca
gaagaactggcgttccctaactctgttatacagtatctgcagggctacattggagaacca
ccatttggatttccagaacctctgaggagtaaggtgttaaaagataaaccaagaattaaa
ggcaggccaggggaatctttgccagacatggactttgatcaattacattcacagttggtt
gaaagacatggaaagaatgtcacagataaagaagtgatgagcgctgccctctatcctaaa
gttactgaagaatacctagaattcaaggaaacatatggcccggtacaaagactggaaagc
aaattattcttcacaggacctctcattgggcaagaaatccaggtggaaattgagaaggga
aaaaccttgcacatcaagaccttggcagtgtctgagaaactgaccaagactggagaaaga
gaggtgttctttgagctcaatggacagttaagatctgttctagtcaaagatctggaagct
atgaaggaaatgcacttccatcctaaggctctaaaaggagtcaagggttccattgggtct
ccaatgcctggaaacgtggtagacatcaaggtgaaggaaggggacagggttaaacaggga
gatactcttttggtgctgtccgccatgaagatggaaatgactgtcactgctccaattgat
ggcattgtgaaaaaagtagctgtcacaaaagacatgaaactggagggagatgatttgtta
atggaaattgaggcctga

DBGET integrated database retrieval system