KEGG   Lingula anatina: 106172347Help
Entry
106172347         CDS       T04921                                 

Definition
(RefSeq) maleylacetoacetate isomerase-like
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
lak  Lingula anatina
Pathway
lak00350  Tyrosine metabolism
lak01100  Metabolic pathways
Module
lak_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106172347
Enzymes [BR:lak01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     106172347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C_2 GST_C Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 106172347
NCBI-ProteinID: XP_013408454
UniProt: A0A1S3JEY5
Position
Unknown
AA seq 177 aa AA seqDB search
MARPILYTYFRSSASWRVRVALAYKGLEYESRPISLIKDGGQQKSAEYTALNPLQQVPCL
IIDGATLTQSLPIIEYLEETRPNPPLLPKDPVLRAKARQTAETINAFTQPLSNSTVLGLV
GEWCGEDKKEKWAGIWIDKGFTGLEKVLEKTAGKYCIGDEITIADVALGPQIFNANR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggccaatattatatacttacttccgaagctctgcttcatggcgagtaagagtt
gcactggcatacaaagggttggaatatgaatcgagaccaatcagccttataaaagatggt
ggacagcagaagtctgcggaatatacagcccttaatcccctgcagcaggtgccttgcttg
atcatagatggagccactttaacacagtctttgcctattatagaatatttggaagaaaca
agacctaatccaccactgcttcctaaagacccagtgctgcgtgcaaaggcaagacagaca
gctgagacaattaatgcctttacccagcccttgtcaaactcaacagtgctgggcctggta
ggagaatggtgcggtgaggataaaaaggaaaaatgggcaggaatatggattgataaaggt
tttacaggattggaaaaagtccttgaaaagactgcaggaaagtactgcattggagatgaa
ataacaattgctgatgtggctttggggcctcaaatttttaatgcaaaccggtaa

DBGET integrated database retrieval system