KEGG   Lingula anatina: 106172880Help
Entry
106172880         CDS       T04921                                 

Definition
(RefSeq) uncharacterized protein LOC106172880 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
lak  Lingula anatina
Brite
KEGG Orthology (KO) [BR:lak00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lak01001]
    106172880
   01009 Protein phosphatases and associated proteins [BR:lak01009]
    106172880
Enzymes [BR:lak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106172880
Protein kinases [BR:lak01001]
 Serine/threonine kinases: Other
  Wnk family
   106172880
Protein phosphatases and associated proteins [BR:lak01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106172880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Bactofilin
Motif
Other DBs
NCBI-GeneID: 106172880
NCBI-ProteinID: XP_013409248
UniProt: A0A1S3JFW3
Position
Unknown
AA seq 3308 aa AA seqDB search
MSKGKHSIPNGKATENELIEAQKKEESSSSTPKKSRFSFASKRSRSPRNTAKSSSVEHLA
DGRSSPKNVQKTKPSKPTFWKSMGGRLTSHHGQYKVSADKGGNDHGDKGVCQHYKSSSPT
ISKDKPTVKTKGGKMAEDPNKVVLGSGSSSKQSVTERKKEESLRSMVTEVIDSEEGKSKG
AGSDTVSSRTRHSSEPALLGVNGDSGKHETLKPSVVPDTKVSTPDDKSKLEARTKGTNAN
NAKPALRVANQTASSAVASKGKRVTIHEETTEININDEAISAINKELKEPIPDDSITIKA
SVSQKETVSASASETSLQGNLQTHLSELIQKEGSEKTEKEEEGEQAVGTSPTGRFLKFDI
EIGRGSFKTVFKGLDTETGVAVAWCELQDKKWSKTERQRFKEEAEMLKGLQHPNIVRFYD
SWELVSPRGQKVIVMVTELMTSGTLKTYLKRFKKVNIKVLKNWCRQILKGLYFLHSRNPP
VIHRDLKCDNIFITGTTGSVKIGDLGLATLKNKSFAKSVIGTPEFMAPEMYEEHYDELVD
VYAVGMCMLEMATSEYPYSECTNAAQIYRRVTTGVRPESLEKVENPEVKEIILACTKLDK
TERPSVKELLQQNFFQEDTGVKVELVGREGLDEAKLPCIIQLMLRVMDPKKRKDKHKENE
AIQFDFDMLKDNAEAVTAEMVKSGYLQEVDVKSVAKQILDRVNQVKKSRERKALESAQQK
PVEGAEQGHVEGQGQGQVQGQQQPVSYGQQQVYTQPQTAPLQQQQQPPQPQQLQQQQQQQ
PPQPQQQPQYQGQQLLHTQMSQLPQGSMSDIAGAVESGFSAMEPGQHSLPSGQTVQGGPP
AQQTISAPAQPAPTYAQQVAAQLPGQYQQQVPAFGYFLPQGTNQTQYTNAQTQQQPPLQQ
QQQQLQPQQQQLQQNQQQQYVQPSFVQQQQPQQQQQQQLPSVQVHCGSCGSWQHVFQGQG
GQDPHHVAADHASLVAQQQLQQQQQQQQPTQPQQVQQTGPHHAATEGRLHVDMAAAQQFQ
QQQQQHLQQQQLPQQQQETQPEVEGSEQVLQHHLLNLDGESTSTPVQRMHVGNEQQQRRP
SLVSDIEGGQAGEKSVKKKSRTKRRKTQDRLVRVTILNIEEQEEGNLVECLLEVAKEKQV
TFKFDISEDGPGDIAENLMIRQLLQAQHKELFQDQMGEVIALVKANPKLLELGGHVCVPH
TTDNTPVTSPRSSRKQMAPQEQQALQREGESNRKLLFDNMSETPMQPGTSVDYDEPRFFL
PRTPSGSSLASGANTPALNVTGKGNGPSGGVVAGGTTVFAGTKSVAASAPVLVGTGQQAT
AVSGLTTGDQASSTASVPAAMVSTGQPAGGATAVQAGGGKVQTGGQPMAAAMTTSTEDGI
PKSEDPLTKSWPTDQLQEATRQTYSRMVSAPGEDLTAAAQPTASVPLHLNDLKEQLDKLN
QKQKPVPAEQQGESQAKVDSDASLAAVSEDKITASSDSESPALTGDKGPSRQLSKTKRKR
TQDRLPVLTVLTYQSTDQGRVVECQLDGAKSRMVTFTFDIDVDKPEDIVENMCSGSFLLP
IHKDYFMEQLEEVIKIMTTNPQALDAGSFTVPQLKETTPATSPSLSRKGSAAADSEVEAR
KKSDTSEVHRAAPCSATEPVTVPTDYEASGVMTRSATAIGLSQADTVQAPPAGGREDPET
GTGFQRTSSAPGEPAAFVPEGLHKLNQQLTQLSQRKTPAKVQEQQPEGQGQAAGQGQGQI
EGQGQAAQTQQPGMAMVQNAQYVQQQPALVQQQQTQQQQQQLQQQQQQQQQQQTAPKQVQ
HPPQGQPQQPVQTQQAQQAKQPAPAQQPKVAAPTQTAPGGAHPQFLPPYVYPLAPQQQQQ
WLQYQQMMNQQGYPMQQYYGPPFYPPWYPPLQGQPQQYLYQNAYVANYLQQMMPFMQMQG
QMPQQQQMAALPYQQQMGQGQVQGQGSHPQSPVGTPRKNTGGADEGVITTQPQGLDSAVV
DLLPLTPSRQRRMIGLQQLEQQLIEKLYPGTKVAHGFQTSPPPAGAVNAPPGHLLLTQPL
FPPPLLPGSLEASAGAVVPSATSSGAGVGGEMGALPLPLSSITREKSPDVSGQDDKPADG
SLPGEVPTTVPSSKQAETEQPASTEAPTTEAPVPAAREKVAAPPKRKLSRFSVKKVDNDP
LKAIQRTESEPAMPARPMDSPADAKPATETVPSTGGKGHQQSTQQARRKGRFSVTTTKDA
VAQSAAPSHTPPPSPSPVTETLPTTTTKSIDSSASTTTVITTKPAEGALVDNSNTATSDV
ELSVKTDVGDKPPPPTTTATTAPAAGGGLRDVSSTEHLQTVSNTVTSIGQESGLGSSGAS
SPVGDFLEHEHEHDRHYDTLPPVVANLIAADLRRHSLPEVLSNSMSSLPGSGSTVLSSTS
SSSHHISPHRPPLHPKVSHLRAQSAGNVAFPLKPSQQQQQQIQQFLQQQQLQQQQGPVTS
SVSGFGVVPGGVKHAYVLSDGQYQSDHPDPTTAGLKKTPVTADPGLKVPTVLLSTTSDTC
STATIVVSPHCNIAAAAATTSVINPDHQIQIHEATSPEELAKGLHVDDALINTLSPQLNY
IFHHDHDHANQPNQLLTVSEPSGRRRSLSVNCCMETCSPPSPPTLTRREYAGSSPSLYDE
TDSYPSFINYKTRSTPQSPTPTRYGHSSFQFPPNLPLEYDQTASKLYPQRSPSPNPRLSP
KPSSAFTHNWPKLGNPPSRPQDFSEQQSVYRPRRGSVPEPSSPLVHRDHSRPSDCRDTFH
SIPVDSRDGRSHYDYGFTSSSSSSSWQDYSTTKPFLEVVPGLQGFGNAASNFVEFGHDVV
PENPGQIMNMLYQVQYTMDPEYQQILSRHKSERDDLIQKQTGELHEYHKHKMQLFKLQHH
QQQQQLLHQQQQQQHQVGGGGRTSDTQQQQQAPAGTVPQAAEGAEVERRSIDMPDTKTGA
LSQQQQQQQQQQQAQHFGVPAASLSYPQLYHPAMFVPQQASLHHQMETLMEGKTQNVADD
FLHYTDFSRAGQQQQLMMEQPKPSQNQLKQMQQQFDNMHVGVPVKRTQSLKGETCTQGQQ
VLDISHPHSHHSGSAGTTPQSTPPLTRKWSTESLPQMTTASTHQPGVDSNSNNSMPPTGT
SMNYSNVSLPEQQYYTYHGHGSISGHYMGAGGGQGMPQHPPPHPHGMHPVHHGQQMYGAG
VPMYSQPLQHYVHGQGQIAPQGQIHGQGQIAAQGHLHGQGQIAPQGQMHGQGQIPSQGQM
HGQGQIAAQGQMQVQGQMHGQGHIPGQGQMHGQGQMLGQGQMSDVWPTSQVTTYPAHTIQ
APSASHPS
NT seq 9927 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaggtaagcacagcattccaaatgggaaagccacagagaatgaacttattgaa
gcacagaagaaggaggaaagttccagcagtacgcctaagaaaagtagatttagttttgca
tcaaagcgatcacgatcgccacgcaatacggccaagtcttcttcagtggaacacttggcg
gatggaagaagcagcccaaaaaatgttcagaaaactaaaccaagtaaaccgactttttgg
aagtccatgggaggtcgcctgacatctcatcacgggcaatacaaagtgagcgcagataaa
ggtggaaatgatcatggggataagggggtttgtcagcattacaagtcttcctccccgact
atttccaaagacaaacctactgtgaaaacaaaaggaggcaaaatggcagaagaccccaat
aaagttgtcttgggtagtgggagcagtagtaaacaaagtgttaccgagcgaaagaaggag
gaaagtctccgctctatggtaactgaagtgatagactctgaggaaggaaagtccaaggga
gctggcagtgatacagtttccagtagaaccaggcacagcagtgagccagctctactgggc
gtgaatggagatagtggtaaacatgagactttgaaaccatcagttgtgcccgataccaaa
gtaagcactcctgatgataaaagtaaacttgaagcaaggactaaaggcacaaatgctaat
aatgccaagcctgctttgagagtagctaatcagacggcaagtagtgccgttgcgagtaaa
ggaaaacgtgtgacgatacatgaagaaacgactgaaataaatatcaatgatgaagctata
agtgcaattaataaggaattgaaggaaccaattccagatgacagtattacgataaaggca
agcgtcagccaaaaagaaactgttagtgcttctgccagtgaaaccagtttacaagggaac
ttgcagacgcacctgtccgagctcatccagaaagaaggcagtgaaaagacagaaaaagag
gaagaaggcgaacaagcagtggggacgtcaccgactggccgatttcttaaatttgacata
gagattggccgtgggtcgttcaagactgtgttcaaggggttggatacagagactggagta
gctgttgcttggtgtgagctccaggacaaaaaatggagcaaaacagaacgtcagcggttc
aaagaagaagccgagatgttgaaggggctacagcatccgaacatcgtgcggttctacgac
tcctgggagttggtgtcaccaagaggtcaaaaggtcattgtcatggtaacagagctgatg
acatcaggaacattgaagacgtatctgaagagattcaagaaggtcaacatcaaggtcctc
aagaactggtgtcggcagatcctgaagggactctacttcctgcacagtcgcaatcctcct
gtgatccaccgagacttgaaatgtgataacatcttcatcaccggtaccaccggcagcgtg
aagatcggtgatctgggtctggcaaccctgaagaacaagtcttttgctaaaagtgtgata
ggtacgccagagtttatggcgccagaaatgtatgaggagcactatgacgagttagtggac
gtgtacgcagttggcatgtgtatgcttgagatggcaacgtcagagtatccatattcggaa
tgtacaaatgcagctcagatatatcgaagggttacaactggcgtgagaccagagagcttg
gaaaaagtggagaaccctgaagtgaaggagataatcctggcatgcaccaagctggacaaa
acagaaaggccctcagtgaaggagctcctccagcagaatttcttccaggaagacacaggg
gtgaaggtggagttggtaggcagggaggggctggacgaggccaaactgccctgtattata
cagctcatgctgcgcgtgatggaccccaagaaacgcaaggacaagcacaaggagaatgaa
gccatccagtttgactttgacatgctgaaggataatgctgaggctgtcacggccgagatg
gtgaagtccggctatctccaagaggtggacgtgaagagcgttgccaagcagatcctggac
agggtgaaccaggtgaagaagagcagagagaggaaagccctggaatcagcacagcagaaa
cctgtagaaggtgctgagcagggtcatgttgaaggtcaaggtcagggtcaagttcaaggt
caacaacagcctgtctcctatggacaacagcaggtgtatacacaacctcagactgcgcca
cttcagcaacagcaacagcctccacaaccacaacaactacaacaacaacaacaacaacag
ccaccgcagccccaacaacagccacagtaccagggacagcaactattacacactcagatg
agccagcttccccaggggtccatgtcagatatagcaggtgcagtggagagtgggttttct
gcaatggagcctggtcagcacagtcttcccagtggccagacggttcaaggtgggcctccc
gcccagcagaccatctctgctccagcccagcctgctcccacctatgctcagcaggtggca
gcacaactgccaggacagtaccaacagcaggtgccagcgtttggctactttcttccacag
ggaacaaaccagacgcagtacacaaacgctcagactcagcagcagccgccgttacaacaa
caacaacagcaattgcagcctcagcagcagcagttgcagcagaatcagcagcagcaatat
gtacaaccaagctttgtgcagcagcaacagccacagcaacaacaacagcagcaactgcct
tctgttcaagttcactgtggctcttgtggttcttggcaacatgtgtttcagggccagggt
ggacaggatcctcaccatgtggctgcagatcatgcttcactggtagcccaacaacaactg
caacagcaacaacagcaacagcagcctacccagccgcaacaagtccagcagactggaccc
catcatgcggcgactgagggtcgactgcatgtagatatggcagcagcacagcagtttcaa
caacaacaacagcaacatttacaacaacaacaactgccacaacaacaacaagaaacacag
ccagaggttgagggttctgaacaggttctacagcatcatcttctgaaccttgacggagaa
tccacgtcaactcctgtacaaagaatgcatgttggcaatgagcaacagcaacgacgtccc
tctctagtcagtgatatcgaaggtggtcaagcaggggagaagtccgtgaagaagaagtca
aggacgaagcgtaggaagacgcaggatcggctggtgcgggtgaccatcctgaacatcgag
gagcaggaggaaggcaacctggtggaatgtctgctggaagtggccaaggagaagcaggtc
acctttaagtttgatatcagtgaggatggacctggggacattgctgagaacttgatgatc
cgccagctgctccaggcccagcacaaggagttgtttcaggaccagatgggggaggtgata
gccctggtcaaggccaatcccaaactgctggagctgggtggtcatgtctgtgtcccccat
accacggataacactcctgtgaccagccccaggagctctaggaaacagatggcaccccag
gaacaacaggcattgcagagagagggagagtccaatagaaaacttctgtttgacaacatg
tcagagactcccatgcagccagggacatcagtggactatgatgagccgcgtttctttctt
cccagaacaccctctggctcttccttggcctctggtgccaacactcctgctctgaatgtt
acagggaaggggaatgggccttcaggtggagtagtggcaggtggaaccacggtttttgca
ggcaccaaatctgttgctgctagtgctcctgtactcgttggcactggtcagcaggccaca
gcagtcagtggtttgaccactggtgaccaggccagctcaacagcgagtgttcctgctgcg
atggtaagtactggtcagccagcaggtggagccactgccgtccaggctggcggtggtaag
gtacaaactggagggcaaccaatggcggcagcaatgacgacatccacagaggacgggatt
cccaagagcgaggatcctctcacaaagagttggcctactgatcagttacaagaggctacc
agacaaacgtacagtagaatggtatcagcccctggagaggacttgactgccgctgctcag
ccgactgcctctgtccccctgcatctgaatgatctcaaggaacagttagacaagctgaat
cagaaacaaaagccagtgccagcagaacagcagggagagagccaagccaaagtggacagt
gatgcctccctggccgcagtatctgaggacaagatcacagcaagcagtgacagtgagagt
ccagccctcacgggggacaaaggccccagtcgccagctgtccaaaaccaagcggaagagg
acacaggaccgactgccagtgttgaccgtcctcacgtatcagtccactgaccagggacgg
gtggtggagtgtcagctggacggggcaaagtccaggatggtcactttcactttcgatatc
gacgtggacaagcctgaagatattgttgagaatatgtgttcaggcagctttctcttgcct
attcacaaagactactttatggagcagctggaggaagtgatcaagatcatgaccaccaac
ccgcaggccctggatgccggctccttcaccgtgcctcagcttaaagagaccacgcctgcc
accagtcccagcctctccaggaaggggtctgctgccgctgacagtgaagtggaggctaga
aagaaatcagatacatcggaggtccacagagcagccccttgctcagcaactgaaccagtt
accgtgccaacagattatgaagcctctggggtgatgacccgatctgctactgccattggg
ttgtcccaggccgacaccgtgcaggccccccctgctggtgggagggaagacccagagaca
gggactgggttccagagaacctcctctgctcctggggagcctgccgccttcgtgcccgag
ggtttgcacaagctgaaccagcagctgacccagctttcacagaggaagactcctgctaag
gtgcaagagcaacaaccagaaggtcaaggtcaggcagcaggccagggtcaaggtcagata
gaaggtcaaggtcaagcagcacagactcagcaaccaggcatggcaatggtacagaatgcg
cagtatgttcaacagcagccggctttggttcaacaacaacagacacagcaacaacaacaa
caactacaacagcagcaacagcagcaacaacagcaacagacagctccaaagcaagtgcaa
catccaccgcaaggtcagccacaacagcctgtacaaacacaacaggcccagcaagccaag
cagccagcaccagctcaacaaccaaaggtggcagcaccaacacaaacagccccaggagga
gctcatccccagtttctccccccctacgtgtaccctctggcgccccagcagcagcagcag
tggctgcagtaccagcagatgatgaaccaacaggggtatcctatgcagcagtactatggc
ccacctttctacccaccttggtatccacctctacagggccaacctcaacaatacttgtac
cagaatgcatatgttgccaattatcttcagcagatgatgccattcatgcagatgcaggga
cagatgcctcagcaacagcagatggcagccctgccataccagcaacaaatgggtcaaggt
caggtgcaaggtcaaggttcacaccctcagtctcctgtaggaaccccaaggaagaacacc
ggtggtgcggatgaaggtgtcatcaccactcaaccccagggacttgattctgcagtggtg
gatctgctccccttgactccctccagacagcgcaggatgataggcctacagcagctggag
caacagttgatagagaaactctaccctggaaccaaagtggcccatgggttccagacctcc
cctccaccagcaggagctgtgaatgcgccaccagggcacttgctcctcacacagccgttg
ttccctcccccgctgctgcctgggtcgctggaagcctctgcgggtgctgttgtgccctct
gccacctcctctggtgctggtgttggaggagaaatgggagcacttcctcttcctttgtct
tcaataaccagagagaagagtccggatgtttctggtcaggatgacaaaccagcagatggt
tccttgccaggggaagtgcccacaacagttcccagcagtaaacaagcagagacagagcaa
cctgcgtccacagaggctcctacaacagaggcaccagttcctgcagcaagagagaaagtt
gctgctcctccaaagaggaagctgtctaggttttcagtgaagaaggtggacaacgatcca
ctgaaggcaatacagagaacagaaagtgagccagcaatgccagcccgtcccatggatagt
ccagcggatgccaagccagcgactgagacagtgccctctactggtgggaaaggtcatcaa
caaagtacacagcaagcccggagaaaggggcgtttcagtgtgacgacaaccaaggacgct
gtagcccagtctgcggccccttcacatactccaccgccgtctcccagtccagtgacagag
acactgcccactaccaccactaaatctatagacagttctgcttctactaccactgttatt
actactaaacctgctgaaggggcattggtagataatagtaacacagcaacttctgatgta
gaactgagtgtgaagacagatgttggtgataaacccccaccaccaacaacaacagcaaca
acagccccagcagctggtggtggattgagagatgtaagtagcacagagcacctgcagact
gttagtaacactgtcaccagtatagggcaggagagtggtttgggaagtagcggggcctcc
tctcccgtgggagactttcttgaacacgaacatgaacatgacaggcattatgacaccttg
ccgccagtggtggcaaacttgatcgctgccgacctacggcgccattctctgcccgaggtg
ctctctaacagcatgtcttctttacctggtagtggtagcactgttttaagttccactagt
tctagtagtcatcacatctcccctcacagacctcctctccatcctaaagtcagccacctc
cgagctcagagtgctggcaatgtggctttccccctgaaaccttcacaacaacaacagcaa
caaatacaacaattcctacaacaacagcaattacagcagcagcagggtcctgtaacctcc
tctgtgagtggctttggtgttgtgcccggtggtgtgaagcatgcttatgttctgagtgac
ggtcagtaccagagtgaccaccctgacccgaccacagctggactgaagaagactcccgta
acagctgaccctggcttgaaggtaccaactgttctgttgagcactactagtgacacttgt
tccactgctaccattgttgtatcacctcattgtaacattgctgctgctgctgctactact
agtgtcattaaccctgatcaccaaattcagatccatgaagccacctcgcctgaggaacta
gccaaagggttgcacgtggatgatgctcttattaatacattgtcaccccagcttaactac
atatttcatcatgaccatgaccatgctaaccaacctaaccagctactaactgtcagtgaa
ccgtcggggcgcagacgctctttgtctgttaactgctgcatggagacatgcagtccaccc
tctccacctacactaacacgcagggagtacgccgggtcttccccttcactttacgatgaa
acagactcttatccttcatttataaactacaaaaccaggtccacgccccagtccccgaca
ccaacccgttacggacatagctctttccagtttccaccaaacttgcccttggaatatgac
cagactgcctctaaattataccctcagcgatccccaagtccgaatcctcggctgagtccc
aaaccatcctccgccttcactcataactggcctaaactcggaaaccctcccagtcgcccc
caagatttcagtgaacagcagtcagtgtataggcctcggagagggtctgtcccagagccg
agtagtcctttagtccacagggaccacagtcgtccctctgactgcagggacacctttcac
tccattcctgtggactccagagatggccgtagtcattatgactatgggttcacttcctcc
tcctcctcttcttcctggcaggactactccactaccaagcctttccttgaggtagtgcct
ggcttacaagggtttgggaatgctgcctctaactttgttgaatttggccatgatgtggtc
ccagaaaaccctggacagatcatgaatatgttgtaccaagtccagtataccatggaccct
gaatatcagcagatactctccagacacaaatcagagagggatgacctgatacagaaacag
acaggagaactgcacgagtaccacaaacacaagatgcagcttttcaagctccaacatcac
caacagcagcagcagcttctccatcaacaacaacaacaacagcatcaggtgggagggggt
ggcaggacatcagacacccaacaacaacaacaagcacctgctggtacagtgccccaggct
gcagagggggcggaagtggagagaaggtcaatagatatgccagacaccaaaacaggggct
ttgtcccagcaacaacaacaacaacaacaacaacaacaggctcaacacttcggtgttcct
gcagccagtctttcctacccccagctctaccatccagcaatgttcgtcccacagcaagct
tcacttcaccaccagatggagacactgatggagggcaaaacccagaacgtcgcagatgac
tttctgcattatacagacttttcccgagctggccaacagcagcagctgatgatggagcag
cccaagccgtctcagaaccagctgaagcagatgcagcagcagtttgacaacatgcacgtt
ggggtgcccgtgaagaggactcagagtctgaagggagagacctgtacccagggtcagcag
gtgcttgatattagccaccctcactcccaccacagtgggtcagcgggcaccacaccccag
tccactccccctctgaccaggaagtggtccacggaaagcttgccgcagatgaccacagct
agtacccaccagccaggtgtggacagcaacagtaacaacagcatgccccctactggtacc
agtatgaactattccaatgtttccctccctgagcagcagtattacacataccacggacat
ggatccattagtgggcattatatgggtgcgggtgggggtcaggggatgccacagcaccca
cctccacacccacatggcatgcacccagttcaccatggacagcagatgtatggggctggg
gtccccatgtacagccagccactacaacactatgtgcatggacaaggtcaaattgcaccc
caaggtcaaatacatgggcaaggtcaaattgcagcccaaggtcatttgcatggccaaggt
caaattgcaccccaaggtcaaatgcatggacaaggtcaaattcccagtcagggtcagatg
catgggcaaggtcaaattgcagcccaaggtcaaatgcaggtgcaaggtcagatgcatggc
caaggtcatattcctggtcagggtcaaatgcatggccaaggtcaaatgctgggtcaaggt
caaatgtcagatgtatggccaaccagtcaagtgactacttatcctgctcatacgatacag
gcaccatcagcatcgcacccaagttga

DBGET integrated database retrieval system