KEGG   Lingula anatina: 106172959Help
Entry
106172959         CDS       T04921                                 

Definition
(RefSeq) sulfhydryl oxidase 1
  KO
K10758  thiol oxidase [EC:1.8.3.2]
Organism
lak  Lingula anatina
Brite
KEGG Orthology (KO) [BR:lak00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106172959
Enzymes [BR:lak01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     106172959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_SOX Evr1_Alr Thioredoxin QSOX_Trx1 Thioredoxin_2
Motif
Other DBs
NCBI-GeneID: 106172959
NCBI-ProteinID: XP_013409366
UniProt: A0A1S3JGU2
Position
Unknown
AA seq 577 aa AA seqDB search
MRGTKAVWVKARSSTNHLVTGASQQKDAMGALFKVLLLTWAAGIWTPATGRGLYTENDPT
ALLDENNFNTTVFRSPSAWLVEFYMDWCGHCQRFAATWNALGRTVQDWSSVIKIGAVNCA
EAINRALCQRNGVIFVPTLKFFQQDASASDNSPYYDGKEEASLIRSAMLKFLISHPNASN
IWPFLFPLQSPVDVLTEGSTGGYLKAVIVEANENDTLAMEVILSMLPDRRVTVRRLVGGR
DVTEFPSMYQVLQNGRQRLLLSGKNDTGSYISLLKQVAGETIASTTPRPTTERVTTISSK
ETRPRVYMQDLESGLHFAFTQEVPLHSSLKDGDLENLKAFIDVLAKYFPGRPQVHLYLQR
LNNWLQGQSMVSVDQWLNQLSKLQSREASLPDTTKWVGCKGSADNYRGYPCSLWTLFHTL
TVNAAAVNKYNSNWEPAEVLVAMNGYIQSFFSCHECAENFGLMAAGITTGETNKAYGIMW
LWEAHNKANKRLHEDITEDPAFPKIQFPSYSACPSCHMTIPATNQDKPVWNRPGVLRFLQ
KMYGKENIVQDTVPVASTSRAQTKTTNPLMYMFIFVH
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgagaggaacaaaagcggtttgggtaaaagcacgttcgtcaacaaatcaccttgtcacc
ggagcgtctcaacaaaaggacgccatgggcgctttatttaaagtcttactcttgacatgg
gcagcaggcatatggacaccggctaccggacgcgggctatacacagaaaatgacccaact
gccctcttggacgagaataattttaacaccacggtttttcgttctccgagtgcttggctt
gtggagttttatatggactggtgtgggcattgccagcgatttgctgcaacttggaatgct
ttgggacgtaccgttcaagattggtccagtgtcataaagataggggctgttaattgtgca
gaagccataaatagagctttgtgtcagagaaatggcgtcatatttgtgccaactttaaag
tttttccaacaggatgccagtgctagtgacaattccccatattatgatggaaaagaagaa
gccagccttattaggagtgctatgctgaagtttctcatcagtcatccgaatgccagcaat
atatggccctttttattcccattgcaatctccagtggacgttttgacagagggcagcacg
ggaggatatctgaaggcagtcatagtagaggctaatgaaaatgacacactggctatggaa
gtcattctgtccatgttgccagacaggagagtgactgttagaaggcttgttggagggaga
gatgtcacagagttcccgtctatgtaccaggtcttacagaatgggaggcagcgactttta
ctcagtggtaagaatgacactggcagttacatctcattgttgaaacaagttgctggggaa
acgattgcctctacaacacctcgacctacaactgaacgggttacaacaattagcagcaaa
gaaaccaggcctagagtttacatgcaagatctggagtctgggttgcactttgcctttacc
caggaggtccccctgcacagctcgttaaaggacggagacttggaaaacttgaaagccttc
attgatgtgttagctaagtactttcctgggaggccccaagtccacctgtatctacaaaga
ctgaataactggctgcagggacagagtatggtgtcagttgaccagtggttaaatcagctg
agtaaactgcagagccgagaggcctccctgcccgacaccaccaagtgggtgggatgtaag
ggaagtgctgacaactacagaggttacccctgcagcttgtggacactatttcatacactt
acagttaatgctgctgcagtaaacaagtacaacagcaactgggagccagcagaagttctg
gtagctatgaatggatacattcaaagctttttctcctgccatgaatgtgctgaaaatttt
ggtcttatggcagctgggatcacaactggtgagacaaataaggcgtatggaattatgtgg
ctttgggaagctcacaataaagctaataagcgtctgcatgaggacattactgaagatcca
gcttttcctaaaatccagttcccttcctactcggcctgtcctagctgtcacatgaccatc
ccagcaaccaatcaggacaagcctgtctggaatagacctggtgtgcttcgtttcttgcag
aagatgtatggaaaagagaacattgttcaggatactgttccagttgcttcgaccagcaga
gcacaaaccaagacaactaatccattgatgtacatgttcatttttgtgcattga

DBGET integrated database retrieval system