KEGG   Lingula anatina: 106174133Help
Entry
106174133         CDS       T04921                                 

Definition
(RefSeq) heat shock 70 kDa protein 1
Organism
lak  Lingula anatina
Pathway
lak03040  Spliceosome
lak04141  Protein processing in endoplasmic reticulum
lak04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:lak00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106174133
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106174133
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106174133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 106174133
NCBI-ProteinID: XP_013411001
UniProt: A0A1S3JLJ3
Position
Unknown
AA seq 565 aa AA seqDB search
MSKPGRLALGIDLGTNFSCVGVHRHGRVEIVPNDFGNRTTASYVTFTDSGRLVGDSAKEQ
AIINSSNTVCDAKKLIGRSFNDVTHLIDRWPFSVSNDGGKPTIHAKYKGERQTFAPEEIS
AMVLAKLKESAEAYLGQAVTDAVITVPVDFSEVQRQATLDAAVIAGLNVLRIITEPTAAV
LAYGLPDKLHDPDIKNVLVFDLGGNSLQVSVLSSEKGIYKILTKSVDAHLGGEEFDNRMV
NYFVKEFKRRYQKNISKDKHSIHRLRIACEHAKRVLSNNIQANVEVENLFEGIDYFTMIT
RSKFEEICIDLFFDILKPVERALKDCRLDKCDIHDIILVGGATHNPKIQQVLQNFMGGKE
LKKSISPDEVVAHGASLQAALLTGVKDDTTKDLTPVTIDLVPLSLGIETTGRKMTKLIQR
DSIYPITVTQIFTTDYDNQPDACIHVYEGEEAMAKDNHLLATFELTGIRPAPRGVPRVEV
TFHIDEEGLLHVTSKDISSGSSTSMDVNIDRTLLSKEAMGNMMTKADKFFADHDQSVDSK
KYMKPYVLGCKKAVISTIRKITSEV
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacctggtcgcttggcactcggcattgatttaggcacaaacttttcctgtgtg
ggtgtgcaccggcatggaagagtagaaattgttcctaacgatttcgggaacaggacgacg
gcaagctatgtcacttttacagacagcgggcgattagtaggcgattctgctaaggaacag
gctatcataaattccagcaacacggtgtgtgacgcaaagaaattgatcggtcgcagtttc
aacgacgttacccatctcattgatcggtggcctttcagcgtgagcaacgacggtgggaaa
ccaacgattcatgcgaaatataagggggaacgacagacctttgccccagaggaaatcagt
gcaatggtattggctaagttgaaggagtctgcggaggcatacttgggacaggcggtaacg
gacgccgtgatcacggtccctgtcgactttagcgaggtccagaggcaagccactttagac
gctgcggttatagctgggctcaatgtcttacgtattatcactgaacccactgctgcagtc
ttagcctatggcttacctgataaactgcacgaccctgacataaaaaatgtccttgttttt
gatctaggtggtaactcattacaggtttctgttttatcatccgagaaaggaatttataaa
attctcaccaagtcagttgatgcacatcttggaggggaagagtttgacaatagaatggtg
aattattttgtgaaagaatttaagcgtaggtatcagaagaacatcagcaaagacaaacat
tccattcaccgcttgcgaatagcatgtgaacatgccaagcgagtcctgtcaaacaatata
caggcaaacgttgaggttgagaatctctttgagggaatcgactacttcaccatgataaca
agatctaaatttgaagaaatctgcattgatcttttctttgatattttaaaaccagtagaa
agagctttaaaagactgcaggcttgacaagtgtgacatacatgatatcattctggttgga
ggcgccactcacaacccaaagattcagcaagtactacagaatttcatgggtggaaaagag
cttaagaaatccatcagtccagatgaggtggtagcacacggagcctccttacaggcagct
ctgctaactggtgtcaaagatgacaccactaaggacttgacaccagtgacaattgacctg
gtgcctttatcacttggtattgaaaccactggtagaaaaatgaccaagctaatccagcgt
gacagcatctaccccatcactgtcacccagatcttcaccacagattatgacaaccagcct
gatgcttgtatccatgtgtacgagggagaggaggccatggcaaaggacaaccacctctta
gcaacatttgagttgactgggattcgtccagcacctcgtggagtaccaagagttgaagtg
acatttcatattgatgaagaaggtctcttgcatgtcacatccaaagacatctcctctggt
agttctacaagcatggatgtcaacattgacagaactttgttgtctaaagaagcaatgggt
aacatgatgacaaaggcagataaattctttgcagatcatgaccagtctgttgatagtaag
aagtacatgaaaccatatgtgcttggttgtaaaaaagctgttatttcaaccattagaaaa
ataacttctgaagtatga

DBGET integrated database retrieval system