KEGG   Lingula anatina: 106176023Help
Entry
106176023         CDS       T04921                                 

Definition
(RefSeq) neuropeptide Y receptor type 2-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
lak  Lingula anatina
Pathway
lak04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lak00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106176023
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lak04030]
    106176023
G protein-coupled receptors [BR:lak04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    106176023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 106176023
NCBI-ProteinID: XP_013413690
UniProt: A0A1S3JTJ7
Position
Unknown
AA seq 321 aa AA seqDB search
MYNSSDGSAAHGLTVGWRVTGATFGILSFVNGFLGNILILGVLVKDKVINVKGKASLISL
SVCGLCFTLFLLVAIIDTYVNDRWQYGEVLCHVFTFVNLSLFGCSMLQQALIALQRYTCV
IFNNKKLIECPKLLTMNIAFCWVIPPLSMIPSMYEEFKEYHIDSLGTDCIFLSDTEDFQK
ILSFILFIVIPSITIYACYIRIFMVIKKSGNSVVPHDPYAVHVAPPQSAFIQNREIKLCR
MFCVMCAITILGYAPFAFLRALDLAFVVDRGIYVICTALYNIALTSNALIYCLMNKNFSQ
ALRRFWCGSPVTTSNGVTNTN
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtataattctagtgatggaagcgccgctcacggcctgacggtaggatggcgagtgaca
ggtgccacgtttggaatcctgtccttcgtaaacgggttcctaggaaatattctgattttg
ggagttcttgtgaaggacaaagtgatcaacgtcaaaggaaaggccagcttgataagcctc
agcgtctgcggactgtgttttacgctctttctccttgtcgccatcatcgacacgtatgtc
aacgatagatggcagtacggtgaagtgctgtgtcacgtgttcaccttcgtcaacctgtcg
ctctttggttgctccatgctgcagcaggctctcattgctttgcagcggtacacctgtgta
attttcaacaacaagaagctcattgagtgtcccaaattactcacaatgaacatagctttc
tgttgggtcataccgccattgtcaatgattccctccatgtacgaagagttcaaggagtac
cacatcgacagtcttgggactgactgtatatttctctcggacaccgaagatttccaaaag
atcctcagtttcatcctgttcatagtcatcccctcgataacgatatacgcatgctacata
cgtatatttatggtgatcaaaaagagcggaaacagcgtggttccccacgacccgtacgcc
gtacatgtagccccaccccaaagcgcgtttattcagaacagagaaatcaagctgtgccgc
atgttctgtgtcatgtgcgccattactatcctgggctatgctccttttgcctttttgcgc
gccctagatctggccttcgttgtcgatagaggtatttatgtcatttgtaccgcgctctat
aacattgccctcacgtccaacgccctgatttactgccttatgaataagaatttttcgcag
gccttgcggagattctggtgcggcagtcccgtgactacctcaaatggcgtaacaaatact
aattaa

DBGET integrated database retrieval system