KEGG   Lingula anatina: 106177136Help
Entry
106177136         CDS       T04921                                 

Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
lak  Lingula anatina
Pathway
lak04136  Autophagy - other
lak04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:lak00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106177136
   04136 Autophagy - other
    106177136
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lak04131]
    106177136
   03029 Mitochondrial biogenesis [BR:lak03029]
    106177136
Membrane trafficking [BR:lak04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    106177136
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    106177136
Mitochondrial biogenesis [BR:lak03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    106177136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Cytochrom_D1 KASH_CCD
Motif
Other DBs
NCBI-GeneID: 106177136
NCBI-ProteinID: XP_013415278
UniProt: A0A1S3JY20
Position
Unknown
AA seq 574 aa AA seqDB search
MMEGVAKQDWKSTIRDLIKERDKREHQPFLSLIQAHNKLFESVDSVRTKNLQLTLETERL
KHENLELSLKTDSGGGGGVIGAERVRELEQKLFKLQEELTELHRKKGENSQRIIDLNNIL
QEKEREIQSKDGKLSDMESNIRAMVAANKSLEGTIMELEATNQMLKDEQQALQLAFTSLE
EKFRKIHEENNELVTRWMEQKALMADKLNEENDVAFRMRQAKMQRELAEAAKEQVTIKPD
RSHQSSGSISSNPPVPFCLSVSLPTKALCKLDAHEGEVNAIRWSYSGRLFATGGTDRKIK
LWEYKSGTILEELMGKSTGRCETVGTLLGSNAGVMSLDVNTEETLILGASNDFASRVWSL
QDHRLRHTLTGHSGKVLAAKFLGDSNKVVSGSHDRTLKIWDLVSRACIKTIFAGSSCNDL
VTSDGFGSNIISGHFDKRIRFWDTRSESSANEISLQGRVTSLDLSPDRNYLLSCSRDDTL
KIIDLRMNQVTGTFCTGGFHVGCDWSRAVFSPDGEYVTVGGGDGTVFIWDIKKNKVERQL
KEHNHSVVACSWHPGGSMILSCDKQKKVILWSDF
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaggagttgcaaagcaagattggaaaagtacaattcgggacttaattaaagaa
cgcgacaaacgcgagcatcaacctttcctaagtttaatacaagcacacaataaattattt
gaaagtgtggattcagtgcggacaaagaaccttcagcttacgttagagacggaaagacta
aagcatgaaaacctggagcttagtttaaaaactgattctggtggtggaggtggggtcata
ggagcagaaagggttagagagctagaacagaaactattcaagttacaggaagaattgaca
gagcttcatagaaagaagggggagaactctcagaggattattgatttaaacaatatactc
caagaaaaagaaagggaaatccaaagtaaagatggaaagctgtctgatatggaatccaat
atccgtgccatggtggctgctaacaaatcattagagggaactattatggagttagaagca
accaatcagatgttaaaagatgagcagcaagctctgcagcttgcatttacttcattggag
gagaaattccgaaaaatccacgaagaaaataatgagctggtgacgagatggatggagcag
aaagcactcatggctgacaagctgaatgaagaaaacgatgtcgcatttagaatgcgacag
gccaaaatgcagcgggagttggcggaggcagccaaggaacaagtgactataaaacctgac
cgctcacaccagagcagtgggagtatatccagtaatccgcccgtacctttctgcctgagt
gtttccctgcccaccaaagccctttgtaaacttgatgcccatgagggtgaggtgaacgcc
atcaggtggagctattctggccgattgtttgccacagggggcactgataggaaaattaaa
ctctgggaatacaaaagtggcacaatattagaagagctaatgggaaaatcaacaggtcgc
tgtgaaacagttgggactctgttagggagtaacgcaggtgtcatgtctctcgatgtcaat
acagaggaaaccttgattcttggtgcttctaatgactttgctagtcgagtttggtcactt
caagatcacaggttaaggcatacgctgacaggacacagtgggaaggtgttggctgccaag
tttctgggggattccaataaagttgtctcaggaagtcatgacaggacgttaaagatatgg
gatctagtcagcagggcatgtatcaagacaatatttgctggctccagctgcaatgatctt
gtcacatcagacgggttcggcagcaacatcattagtggccattttgacaagaggatacgt
ttctgggacaccaggtccgagtccagcgccaatgagatctctctgcaggggagggtcaca
tcactggatctgtcaccagatcgtaactatctcctaagttgttcaagagacgacacttta
aaaatcatcgaccttcgcatgaaccaagtgacggggactttctgcactggaggatttcac
gtgggctgtgattggtcaagagcagtgttcagtcctgatggagaatacgtgactgtaggg
ggcggtgacggcacagtattcatttgggacattaaaaagaacaaggttgagaggcagctg
aaggaacacaatcattctgtggtagcatgttcctggcatccaggaggatcaatgatttta
agctgtgataaacaaaagaaggtcattttgtggtcagacttctaa

DBGET integrated database retrieval system