KEGG   Lingula anatina: 106178502Help
Entry
106178502         CDS       T04921                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial isoform X1
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lak  Lingula anatina
Pathway
lak00970  Aminoacyl-tRNA biosynthesis
lak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lak00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106178502
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lak03029]
    106178502
Enzymes [BR:lak01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     106178502
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     106178502
Mitochondrial biogenesis [BR:lak03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    106178502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 106178502
NCBI-ProteinID: XP_013417164
UniProt: A0A1S3K425
Position
Unknown
AA seq 544 aa AA seqDB search
MSHTLGRYRRFTSNFQCSYSVYRALTRALHHGQRLSQNARAGWETVVGLEIHAQIASHSK
LFSGAGTQFAAPVNNQVSFLDAALPGTLPVLNRRCAEIGVMTGLALGCHINRESRFDRKH
YFYADLPQGYQITQQRQPLAEKGEIPYYFFVANDMKSPTKLSARIHHIQLEQDSGKSLQD
PEQNMSLIDLNRAGMALMEIVTEPDFRSGEEAAAFVKELQLILTTIGACSGVMAEGAMRV
DATVSVNKVGEPISTGVRVEIKNVNSIRGVAKAIEYEFSRHISLLEKGEKIANETRAFDA
ENVETISMRDKEKVHDYRFMPEPNLPPLRIYDNQTLSSDLSPDQVINVDEIRSSMAATPE
ERRLALQAKYGLSLEHCQVMLTSEGTEDFFTAVMNADTTRDIAIVYQLLFSILLSFTNEH
KIPVDKSPVDIVKFGDTVDLLCSKRITYQVARNIFHQYFEAADNRPVEQMVDEEDWWIIT
DKTLIEEHCKKLMAESPKKVKNHKKGYRECGFHKAIVVRTQGRADPVLARQVVEENMGKF
VKKK
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacacgcttggaaggtatcgaagatttacgagcaactttcagtgctcgtactct
gtttatagagcacttacaagagcactgcatcacgggcagagattgagtcaaaatgccagg
gctggctgggagacagttgttggcttggaaatccacgcacagattgcttcccacagcaag
ctgttctctggtgccggcacacagtttgctgcacctgtcaacaaccaggtatccttcctt
gatgcagctttgcctggaactttgcctgtcttgaacagaagatgtgcagagattggcgtg
atgacagggctggccttgggttgtcacatcaacagggagtccagatttgacagaaagcat
tacttctatgctgatctcccgcaaggttatcaaattactcaacagagacagcccctggca
gaaaaaggggagataccctattatttttttgtagcgaatgacatgaaatcaccgaccaag
ctgtcagcacggattcaccacatccaattagaacaggatagtggcaagagtcttcaagac
ccagaacagaacatgagtttgattgacttaaacagagctggtatggccctaatggagatt
gtaacagagcctgacttccgttcaggtgaggaagctgctgcctttgtaaaggagttacaa
ttgatcctcacaaccataggggcttgtagtggggtgatggcagagggagcaatgagggtg
gatgccactgtgtcagtcaacaaggtaggggagccaatcagcacaggggtcagggtggag
atcaagaatgtcaacagcatcaggggtgtggccaaggctattgaatatgaattcagcagg
catatatcacttttagaaaaaggtgaaaaaatagccaacgaaacaagagcttttgatgca
gaaaatgtggaaacaatatctatgagagacaaggaaaaggtgcacgactatcgtttcatg
ccagagccaaacctccctcctctacgaatatacgacaaccagactctgtcgtcagacctg
tcacctgatcaggtgatcaatgttgatgagatcaggagttctatggctgcaactcctgag
gaacgaagattggcactgcaggcaaaatatggattatcacttgaacactgtcaggtaatg
ttgacctcagagggcacagaagacttcttcactgctgtgatgaatgcagacacaacccgt
gacattgctattgtgtaccaacttttattttcaatattgctctcattcacaaatgaacac
aagatccctgtagataaaagccctgttgacattgttaaatttggagacactgtggacttg
ctgtgcagcaaacgcatcacatatcaagttgcaaggaacatttttcatcaatattttgag
gcggcagacaacaggcccgtggaacaaatggtggatgaagaagattggtggataataaca
gataaaacattgatagaagaacattgcaaaaaactaatggccgaatctcctaaaaaggta
aaaaatcacaagaaaggatatcgggagtgtggctttcataaagcaatagtggtgcgaaca
cagggtagagcagacccagtcttggcgagacaggtggtggaagaaaacatgggaaaattt
gtcaaaaagaaatga

DBGET integrated database retrieval system