KEGG   Lingula anatina: 106179926Help
Entry
106179926         CDS       T04921                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
lak  Lingula anatina
Pathway
lak00071  Fatty acid degradation
lak01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106179926
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lak03029]
    106179926
Enzymes [BR:lak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     106179926
Mitochondrial biogenesis [BR:lak03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    106179926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 106179926
NCBI-ProteinID: XP_013419196
UniProt: A0A1S3KAB7
Position
Unknown
AA seq 616 aa AA seqDB search
MPDCIIWAVLVKFHLQQNRGPYKTFSLQNVLPRLPVPSLEQTCHKYLLSVKPLLTEAEYA
QTKQVVEQFKQNEGPKLQGYLKLRAWNKVNWLSEWWNDLAYLYQRSPIAINSNYYCLDSE
ALPTNNPIARAANMIHYGVLFHDLIHTERLPVLLANGLVPVCMDGYRYMFNACRIPGLEK
DTLHNFPASNFVIVIRKGMFFKLDVYAENKKGVLTPLTPWELQCQLEKIYEMSEEQDDGC
GVAAFTAINRTQWAKHRQALIQASPVNKATLHEVERALWHISLDCGVPKDISDQAKMLLC
GDGVNRWFDKSLVMFAFADGRSGALAEHATADATLFSRLWEYAQFRERYTKNGDVEKQEG
ETVRYLKPPKRLQWDVTGFEDSITSALAEHKANVDDLDMFVQPSDYGKGWIKKKHISPDG
YLQMAMQLAYFRLHGDTPKTYESASTRMFALGRTETIRPISEHSVSFVKAMDNPSATSDT
KINLLKKAVHYQTQYKIDATNGEGCDRHLLGLYCVSKELGMPVPSLYMDKAWQIPEQLST
SQTPTKITHQWSLETCSRGGGFGPVSPEGYGVSYIIVGEDLVNFHISSRKSCRATSSAKM
AKAIVQAMADMRDLLV
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgccagactgtattatctgggctgtattggtgaaattccatttacagcagaatagaggc
ccatataaaacattcagtttgcagaatgtgctgcccaggttaccagtgcccagcttggag
cagacctgtcacaaatatttgttatctgtaaagcctctgctcactgaggcagagtatgca
cagacaaaacaggttgtggagcagtttaaacagaatgaggggccaaaacttcagggttat
ttaaaactcagggcttggaataaagtgaactggttatctgaatggtggaatgacctagca
tatttgtatcagaggagtcctattgcaattaactctaactattactgcctggacagcgag
gcactgcctacaaacaaccctattgctagggctgccaatatgattcattatggtgtgctg
tttcatgatttaattcacactgagcgtctgccagtcctattggcaaatggattggtccca
gtttgtatggatggatacagatatatgtttaatgcctgtcgaattcctggattagagaag
gatacattacacaactttccagcatcaaactttgtcattgtgattcgcaaaggaatgttt
tttaaactggatgtgtatgctgagaacaagaagggcgtactcacccccctgacgccttgg
gaattacagtgtcagctggagaagatatatgagatgagtgaagagcaagatgatggctgt
ggtgtggcggcttttactgcaataaacagaactcagtgggccaagcatcgccaagctttg
atacaagccagtcctgtaaacaaggcaactctacatgaggtggagagggcactctggcat
atatctcttgattgtggggttcctaaggacatatctgatcaggcaaaaatgttgctatgt
ggagatggagttaataggtggtttgacaaatctctagtaatgtttgcgtttgctgatggg
cgttctggtgccttagctgaacatgccactgctgatgccacgctcttttcacgactttgg
gaatatgcacagttcagggagaggtatactaaaaatggtgatgtagaaaagcaggagggg
gaaactgtaagatatcttaagcctcctaaaaggctacaatgggatgtaactggatttgaa
gattcgataaccagtgctcttgctgagcacaaagcaaatgttgatgatttggacatgttt
gttcagccatcagattatggtaaaggctggatcaagaagaaacatatcagtccagatgga
tatctacagatggccatgcagcttgcttacttcagattgcatggagatacaccaaaaacg
tacgaatctgcatcaacaagaatgtttgcccttggtcgcacagagactattcgccctata
tctgagcactctgtcagttttgtgaaagctatggacaaccccagcgcaacctctgatacc
aagataaatctcctaaagaaggctgtccattatcaaactcagtacaagattgatgctacc
aatggagagggctgtgatcgtcacttgttgggactttactgtgtttccaaagagctagga
atgcctgtgccttcactgtatatggataaggcatggcagatcccagagcaactgtccacc
tcccagacacccaccaagatcacccaccagtggtctctggagacctgctctcgtggtgga
gggttcggacctgtgtctcctgaaggatacggagtgtcctacatcattgtaggggaagac
ttggtgaacttccacatctccagcaggaagtcctgtcgtgccaccagctctgccaagatg
gccaaggctattgttcaagcaatggccgacatgagagacttactggtctaa

DBGET integrated database retrieval system