KEGG   Lingula anatina: 106180046Help
Entry
106180046         CDS       T04921                                 

Definition
(RefSeq) titin isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
lak  Lingula anatina
Brite
KEGG Orthology (KO) [BR:lak00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lak01001]
    106180046
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lak04131]
    106180046
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lak04812]
    106180046
   04147 Exosome [BR:lak04147]
    106180046
Enzymes [BR:lak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106180046
Protein kinases [BR:lak01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   106180046
Membrane trafficking [BR:lak04131]
 Others
  Actin-binding proteins
   Others
    106180046
Cytoskeleton proteins [BR:lak04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     106180046
Exosome [BR:lak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106180046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 fn3 ig Ig_2 V-set C2-set_2 Pur_ac_phosph_N Tissue_fac fn3_4 Izumo-Ig Ig_5 Receptor_2B4 fn3_2 C1-set Peptidase_U32_C
Motif
Other DBs
NCBI-GeneID: 106180046
NCBI-ProteinID: XP_023933258
UniProt: A0A2R2MT14
Position
Unknown
AA seq 5657 aa AA seqDB search
MIFEEEEHHHLEIYDVVPEDAGTIKVTAENTAGSASCTATLDVEEKPKDIPTPPKFIVNI
QTTDATVGEQASLRCQAKGVPTPTLVWYKDGREIRPGDNRYTISYDEDGTTTLMVIEVVR
DVAGTYTCEATNKAGKDTTTGDLNVHEVPIQEVPEEEVEEMVAPVIVKKPDQLTVNEKDR
AEFICKITGTPAPQVTWSKGDEELTDTNKYHIEEYEDVYCFEINQAIKEDTGDYTCTARN
PAGEATCTIPLTVKAVPSEELEEVPPKVPEKEEDLSKSPLVLRHAEQTKAPEFSQTLQDV
ILMEGDQLELQCAVSGVPRPEVAWDRAGKTLVPTKVMSISHEEDMCTLTISEVTVDQAGQ
YTCTAVNSAGKAICTSEVRVQERPEAPEFVRPLEKRVVKEGKQVKMDCAVKGKPTPEITW
LLNDTPIEASKRVVLDKRLTDEETVLTMTINEAVLKDSGTVYVTAVNPAGEVKTSAELIV
EAAEIVKKEAPKITRQPENVETFEFNTVTFECSVTGKPEPEVIWLKGNTQLVESDRIHIT
AEEGKHTLTMDKVTTADGGIINVKVSSPAGQQSATAKLRVTPVKPAKIIEKPKDTTVPEH
GTAKFTSKITGTPVPTVTWFLNDQELQPSETVHTDFIKKDNTFTLTIDDCMPDKMGPVKV
VAKNNGGDVSAECKLTVEGRAPSFVQKPIKCTVMEGSTAVFRCRIDGEPMPTVQWSKGKW
KKFTHGGKVKVYRDEETDEQVLEIESITSKDAGTYTVTLKNDKGVEECSATLIVTDDSEA
MEDWRAQLKHISTEEVTGPEVEEIDWQVQLKPTQSPEEQGAEDEGVTVPLRHVSSEEKEE
EEEEKEKPEEVEYKPEDITVQLPEREKVELEPMPEKVKPEKAPSEPKEEEKEKYERKPKE
VTTQEEEAITLEIPKVTWEFIKELEDVTVKEKGVAQFECAVTVQNAAVQWYIDDNEVARS
PKFEVQVDGQTHKLTISNVRPQDSGQVTCKFGDLVSRANLVVEEVPAEFITTLPEESEVT
EGQHLTLTCDISKEDAEVTWFRDKEEIKPTEKIEIRKEGTKHALVVHDMSVDDEAQYTVK
VGDQESTSAVFVHELPAEFSAPLQDTTVQETGEVTLEVELSKEDASATWVLDGEEVQPDE
RHTIEADGKIRRLSIIDVVPEDAGSYALKVGDKTTTAQLFVEEIPAEITQPLKDLTAKES
AVIKLEAEVSKETAEVKWLKDGVEIQVDERHDVEAEGKIRRLSIRDVRSDDEAEYTLKVG
DKESTAKVSVEEIPVEITQPLKDISAKESANITLQAEVSKDTAEVKWLKDGIEIQLDERH
DVEAEGKIRRLSIKDVKSDDEAEYTLKVGDKESTAKVSVEEIPIEITQLLKDISTKESAD
ITLQAEVSKETAEVKWLKDGVEIKVDERHDVEAEGKIRRLSIRDVQSDDEAEYTLKVGDK
ESKAKLSVEEIPVEIIQPLQDITATEKAELTLVTEVSKEKAEGTWLKDGVLIKADKKLDI
TAEGTVRKLSIHDVQPEDAAVYTFKVDDKTETSASVSVEELPAEFKVPLKDTTAKEKEDL
TLEVELTKDDVDATWFIGDAEIKPDDRHDIEVDGKFRRLKIHDAKTDDSARYSLKVGDKA
STATLLVEEIPVEFTKPLKDKRIKEKEDVTLETTVSKDDVQVTWLIGGEEIKPDECHDIE
VDGKVHRLKIHRVKPEDATDYTVKVGDRQTTAKLSVDVIPLKFTVPLKDKSVKEKEDITL
EVELSRDDVDVTWLLDKDEIQPDERHNIEVDGTIRRLTIHDAKPEDSARYTVKAKDKSTS
ARLKVEEIPVKFTVPLKDQTVKEKSEVTLEVEISRDDLEVSWLMDNKKIEPDERHEIFAD
GAKHKLVIHDAKPQDSAKYTVKAKDKSTSARLKVEEIPFKFNVPLKDKTAKEKEDVTLEV
EMSRDDVEVTWLMDNKKIEPSERHEIVVDGKISRLIIHDAIPQDSAKYTVKTKDKMTNAR
LKVEEIPLKFTTPLKDKTVSEKEDVTLEAELSRDDVEVTWLIDNKKVVPDERHDIEVDGT
VHRLIIHGAKPEDSAKYTVKAKDKATTAKLKVEEIPLTFTVPLKDKTVQEGEDVTLAVEL
SRDDVEVTWLIDNKQIKPDDRHDISAEGKIRKLVVHGVQPQDSAKYTVKAKDKSTSAKIK
VEQLEVEFTQPLKDLTAKENEEVTFECKVSQENLDAAWYFGDVKLKSDEKHDITVEGTIH
KMKIKDVSSDDSASYTIKIADKSSSAKLSVEEIEVEFVVPLKDTTTKEQTSVTFECELNK
PVDVTWLVDGTEITSNEKYDITVEGKVHRLTIHGPSITDAVEYTVKAGNKTSTARLTVEE
IDAEFTVRLKDQHVKESETVTFECTVNKPNVPVAWYMGDIDLTSNEKYEITVDGNVHRLT
IHDAQPDDAAIFTAKLPKERCSAKLKVEEIAAEFTVGLQDTKVLEKETVEFTCKLSKPTP
VHWEKKGKEIQDGGRYQISAEGVDVNLTITDAQLDDTAQYSCVLPSGDKTTAKLTVKEAP
FEIMKPLSDVTSPVRGTVTFECEVNKPDKTARWQKNGRAIKHGGKFAISVDGTTHTLTIQ
DVSLEEEAEYTVIIEDKKSSAKLFVEEIAVEFTKELEDTTVTEIPGSAEFECELNQPDVP
IQWLQGDKPLRPSDKHKMVSEGPVHKLLVKEVDDEDDGDYSVVAKDKKSTAKLSVEVPPQ
AFLDEKFQDVFTIKAGKSAIFEVPFTGAPQPSVNWTFQQGALEPARMKVETIRNMTCLTV
NRAIRQDAGNYELTLENPFGKSTVTIRLNVLDKPSPPRELTVADVTSSSVTLTWEEPEDN
GGSDITGYIIEKRDAKRQSWQKVDVVKKRELEVTNLIEGSQLYFRVMAQNDQGVSEPVTL
KEPVLIKCPYDKPGKPGTPQCTDITKNSVTLNWSPPQSDGGSPITSYVVEYKGAGVFKWT
TANTEPVPDTSYTVTRLSEGKDYQFRISAENKAGIGPPSDATDTINIKEPVVGTPPVLVE
GMHDVTAVVPEEALLEADIAPGEPEAEIRWFKDGKQIAPSKKYEMNYVDEVAELVIKETS
TGDAGKYRCEASNAIGKVDTEASLTVHVAPHITYDNKYQGPQTLKSGSTLSLKVEVSGTP
TPTISWLLDGEPMEKSAAVAIETTDTTSGLRVKNVVADDSGKYRVVAENVVGQATADFEV
IIQGKPSPPKNLEVTDYNKDSITVNWQPPENDGGSPIKTYIIERKETRKTSWTNAGKVDG
NTLTFTLTRLLEGQEYTVRVSAENAIGVSEPVELTQPVTAKLPYDVPGTPTNLQAMEVDK
NLIALQWQAPESDGGSPITSYVIERQMGTRTTWTKVNKENTLETTFKVHDVIEGTEYNFR
VSAENKAGVGKPSNTTGKIKAVTPKVAVEFTTPLSEVTVKSGETATLQCEVNKPNMDAKW
LKDGRPIKSGGRFKIIVDGTVHSLVIASAEQADEAQYSVKIDDKTSAALLSVEEEKIDFI
RTLEDVTVKEIPGTAVFECELTTSTQVQWMHDNKPITPSKKYSISVDGTTVHKLTINEAD
DEDEGEYSIAIKGKKSTANLHVQAPPLIRVDKSLEETVTLKAGSSKVFEIPFTGHPQPKV
SWAFNDGPLPDEKRFKVETIRNMTCLRVTKIQRKETGRYAVTLDNPSGKTDITINVNVLD
KPSPPRDLKAAEVSSQEVTLKWTEPEDNGGCDITSYLMEMKEVTMRAWKDAGQTPDLELT
VPRLKKDTKYTFQVRAKNECGVSEPVEIKQPVLAKDLFVKPGKPGKPEVSDITKSSVTLT
WTEPEDDGGAPISNYVIEYKMKSSVRWTKVPEKVSDTTHTVTGLKEDSEYEFRVSAENKA
GVGEPSPVSEPVIVKEPVVGTAPELLSPMSDVTAVMPEKAALSCDISLGEPEAEITWFKD
NKEIKSGKKYEISYAEEVAALVILETDLKDSGQYRCEVANKIGKVTTQAKLTVQAKPELK
YDKSQLSKSLQEGETLTLRVEFSGEPKPQISWLLDGEPADSVTVKTTDTMSTVTVKKVKA
EDAGQYTVVAENPAGKEEVNFEVNISGKPSKPKDLEVTSYNKDSISVAWQPPTDDGGSPI
TNYIIERRDANRATWTNAGTVDGSTCIFTVGKLVEGNQYYVRVSAKNKIGTGEPVELMEP
VTAKLPFDVPDAPTDLTAKDISTKELTLEWKAPEKDGGSPITGYIIECRQARSSRWVKVN
KMPVTKTTYKVTDLIENNEYEYRVCAENAAGLSKPSETTGNIVAKVPFVPIKFVTPLTGQ
SVKEGETVTMECEINKPNQKPQWLKNDTPITPSDRYTMKSDGNKHKLTITDVQPDDAGNF
TIKVEDQTSDATLEVEAEDFEFVVPLKDITVKQIPGVAVFECEISRPVDIAWLRGGKIVT
PSEKYKIEKDSKRVKHTLTIKDVDGEDEGEYALSARGRQSKATLTVAAQPVILSEESYEE
AITLKTGASAVFEIPFSGNPQPTVTWTFNGASLTKPAKEETIRNMTALTLTKVKRSDSGE
YMLKLENASGKASITIKVVVLDKPGPIHDLTSPEATSNSISLKWAEPEDDGGSNIIRYII
EKREQTRRTWQPAGSSTETEFTVTNLVENNKYVFKVSAENAQGTGPAVEIAQAVLAKSSF
VVPSAPAAPTISDIFKDSAVVSWQPPSKDGGSPVIGYLLERCAAPGVRWIRVVHDAIEET
TFKATDLMEGSEYQYRVIAVNKAGESKPSEGSSPFKAKDPWDKPGKPGSPEVEEITSSTV
TLSWSPPSNDGGSPILNYIVEYKATEAFRWLKATEETVAETKLVVEKLRDGDSYEFRVSA
ENKAGTGPPSEVSRAVTVREPISGEAPELVEKITDMAVISPEPATLKCKISPGEPEPEIK
WFKEGKELQTDGKYKTEYKNNTATLVINDTEPADAGKYKCVATNALGKVESVGELRVQVP
PKLEYDNKLREPLKVKEGGSATLSVDIDGVPEPKITWLHDGKPVEKSHRLTVQTRDGTST
LNLKGLTKEDGGKYSVVVENDVGKDTADFEVIITGKPSAPTNLQVKETNKNYITVTWQPP
ESDGGSPIKEYIIERRDASRQTWTQAGTVGGSTFEFMITKLLEGNKYYIRVSASNQLGTG
PPAELKEPVTAKVPFDVPGPPVNLEVFEVSKSHITLAWDAPENDGGADVKGYVIERRVAT
STKWIRINRKLVDDIEYDITDVREGVEYCLRVLAENEAGLSQPSEELGPVLVKEPFDPPD
APAAPEVTDITKRTATLKWSTPEKDGGSPVTGYDIEVKSTVKFRWTSLNLKEPDTVYTVK
DLQPGEKYEFRVVAENKAGRSQPSSPSRQIVAEDRTTGEAPRVVEQLKDVAAAVGGTTKL
ECQIFGSPEPQVKWKKNNRELLPGRKVAMSYVDSVATLTILDTTDSDAGKYICEASNTLA
LVSTSCAVSVNVPPTINLDRKLRDGQSIKTGGSLKMSANIGGSPVPEVVWLKDGEPVVPD
GRVVIENTDSTSSLTIRKAKLDDDGEYTLQLKSPAGEASATIDVEVVDKPQAPADFKVTN
VSKDSVSLEWTKPKDDGGKEVTSYIIERRDAKRPSWMKVTSVPASKFSYTIPNLIEGNEY
FFRVSAVNDIGTGEPAELDLPVLVKSAFEKPSTPKGPLVLKEPHPGLSYTTVAASRWHCS
EICGRKTRLQALQLVRS
NT seq 16974 nt NT seq  +upstreamnt  +downstreamnt
atgatatttgaggaagaagagcaccatcacctggagatttacgatgtggtaccagaggat
gctggcaccatcaaggtcacagctgagaacacagctgggtcggcttcctgcactgctact
ctagatgtagaagaaaaacccaaagatatacccactcctcccaagttcatcgtgaacatt
cagaccacagatgccacagtgggggagcaggccagtctgaggtgtcaggccaaaggagtg
cccacccctacactggtctggtacaaagatggacgtgaaattagacctggagataacagg
tacactatctcctatgatgaagatggtaccaccaccttaatggtgatagaagtggtgaga
gatgtggctggtacatacacctgtgaggccaccaacaaggctggtaaagataccaccacg
ggagaccttaatgtacatgaagtacctatccaggaagtcccagaggaggaagtggaggag
atggttgctccagtaatagtgaagaaacctgatcagcttactgtcaatgaaaaagacagg
gctgagtttatatgtaaaatcactggcacccctgctccacaagtaacttggagcaaagga
gacgaagagctcacagacaccaacaaataccacatagaagagtatgaagatgtgtactgt
tttgagatcaaccaagctataaaagaagacacaggggattatacttgtactgctagaaat
cctgctggagaggcaacatgcaccatcccccttactgtcaaagctgtcccgagtgaagag
ctagaagaagtgccacccaaggtccctgagaaggaggaagatctgtccaagtcgccattg
gtactcagacatgcagaacagaccaaagctccagagttctctcagactttacaagatgtg
atcctaatggaaggagatcaacttgagctgcagtgtgcagtgagtggtgtacctagacca
gaggtggcatgggacagggctggcaagactcttgttcccaccaaagtaatgtccatctca
catgaagaggacatgtgcactctaaccatcagtgaggtcacagttgaccaggctggacag
tacacatgcacagcagtcaactctgcaggcaaggccatatgtacatcagaggtcagagta
caggagagaccagaggctcctgagtttgtgcgtccactggaaaagagagtggtcaaagaa
ggcaagcaggtcaagatggactgtgctgtgaagggaaaaccaacaccagagatcacgtgg
ttgctcaatgatacacccattgaagcttccaagagggttgtccttgacaaacgcctcact
gatgaagagactgttcttactatgacaattaatgaggcagtcctgaaggattctgggaca
gtgtatgtcactgccgtcaaccctgctggagaagtgaagacatctgcagaattgattgtt
gaagctgcagaaattgtaaagaaagaggcccctaagatcaccaggcaaccagagaatgtt
gagacatttgagtttaatacagtaacatttgagtgttcagttactggcaagcctgagcct
gaggtgatatggttgaaaggcaatacacagctagtggaatctgatagaatacatataact
gctgaggaaggcaaacatacactgaccatggacaaggttactactgctgatggaggaatt
attaacgtgaaagtgtccagtcctgcaggacaacagtctgccactgcaaaattgagagtc
actcctgtgaaaccagcaaagatcattgagaaaccaaaagataccacagtgcccgaacat
ggaacagccaagtttaccagcaaaattactggcacaccagtacctactgttacttggttc
ctaaatgaccaagaactacagcccagtgagacagttcacactgacttcattaagaaggat
aacacttttactctcaccattgacgactgcatgccagacaagatgggaccagtgaaagtt
gtggccaagaacaatggtggcgatgtctcagctgagtgtaagctaacagtggaaggcaga
gcgccatcttttgttcaaaaacccatcaagtgcactgtcatggagggcagcactgctgtc
ttccgttgcagaattgatggtgagcccatgcccactgtgcagtggtctaaaggaaaatgg
aagaagtttactcatggaggcaaagtgaaggtttaccgtgatgaggagactgatgaacaa
gtcttggagattgaaagtattaccagtaaagatgctgggacatatactgtcacactaaag
aatgataagggagttgaagagtgctcagctactctaattgtcaccgatgactcagaggct
atggaagactggagggctcagctcaaacatatctcaactgaggaagtcactggtccagaa
gtggaggaaatagactggcaagtccagctcaaacctactcaatctccagaagaacagggt
gctgaggacgagggtgtgacagtgccccttcgccatgtctcatcagaggagaaagaggaa
gaggaggaggagaaggaaaagccagaggaggttgaatacaaacctgaagacatcacagtt
cagcttcctgagcgtgagaaagtggagttggagccaatgccagagaaggtaaagccagag
aaagctccctctgaaccaaaggaggaggagaaggaaaaatatgagaggaaacccaaagag
gtcacaactcaggaagaagaggcaatcactctagaaattcctaaagtcacgtgggaattc
attaaggaactggaagatgtcactgtcaaagagaagggggtggctcagtttgaatgtgcg
gtcacagttcaaaatgctgcagtccagtggtacattgatgataatgaggtagcccgtagc
cccaagtttgaagtccaggtggatggccagacacacaagttgaccatcagtaatgttcgg
ccacaggacagtggacaggtcacctgcaagtttggggaccttgtttccagggctaacctg
gtggtagaagaagtcccagctgaattcattaccacacttccagaagaaagtgaggttact
gaaggtcaacatttgaccttgacctgcgacatcagcaaggaagatgcagaggtcacttgg
ttcagggacaaagaagaaattaaacccactgaaaagattgagatcaggaaagaaggcaca
aaacatgctcttgtggtacatgacatgtcagtagatgacgaggctcagtacactgtcaaa
gtcggtgatcaggaaagcacttctgctgtgtttgtccatgagcttcctgccgagttcagt
gctcccctccaggacaccacagtccaggagactggtgaagtcacccttgaagttgaacta
tccaaggaggatgccagtgccacctgggtgttggatggagaagaagtacagccagatgag
aggcacactattgaggctgatggaaaaatacgaagacttagtatcatagatgttgtacct
gaagatgcaggttcatatgctctcaaagttggagataagaccacaactgcccagcttttt
gtggaagagatcccagcagaaattactcaacctctcaaagacttaactgcaaaggaatct
gcagtaataaagttggaggctgaagtatcaaaggaaactgctgaagtcaagtggcttaaa
gatggagttgaaattcaggttgatgaaaggcatgatgtggaagctgaagggaagattcgt
aggttaagcatcagagatgttcgttcagatgatgaagcagagtatactttgaaagttggt
gacaaggaatcaacagccaaagtttcagttgaagaaattccagtggaaatcacgcaaccc
ctcaaagacatatctgccaaagaatctgcaaacatcacactacaagctgaagtatccaaa
gacactgctgaagtcaagtggctgaaagatgggattgaaattcagttggatgaaaggcat
gatgttgaagctgaaggcaagatccgtagattaagcatcaaagatgttaagtcagatgat
gaagcagaatataccctgaaagtgggagacaaagaatccactgccaaagtttcagttgaa
gaaatcccaattgaaatcacacaacttctcaaagacatatctaccaaagaatctgcagac
atcaccttacaggctgaggtttccaaagaaacagctgaggttaaatggctaaaagatggg
gttgaaatcaaagtggatgaaaggcatgatgttgaagccgaaggcaagattcgtaggttg
agtatcagagatgtccagtcggatgatgaggctgaatacactttgaaagttggtgataaa
gaatcaaaagccaaactctcagttgaagaaatcccagttgaaatcattcaaccccttcaa
gatataactgcaacagaaaaagcagaacttactcttgtgacagaagtctcgaaggaaaaa
gcagaaggtacatggttaaaagatggtgttttgataaaagcagacaaaaaacttgacatc
acagctgaaggaacagtacgcaaacttagcatccatgatgttcaacctgaagatgctgct
gtgtatacatttaaggtggatgacaagacagaaacttctgcatctgtttcagtcgaagaa
ctacctgctgagttcaaagtaccattaaaggatacaactgccaaagagaaagaagactta
actcttgaggtagaactaaccaaggatgatgttgatgcaacatggttcattggagatgcc
gaaatcaaacctgatgacagacatgacattgaagtggatggtaaattccgtaggcttaag
atccatgatgccaaaacagatgacagtgctagatatagccttaaagttggtgacaaggca
tcaactgctacgctgttagtggaagaaattccagtggaattcacaaagccattgaaagac
aagagaattaaagaaaaggaagatgttactcttgaaaccactgtctctaaagatgatgtt
caagtaacctggttgataggtggtgaagagatcaaaccagatgagtgccacgacattgaa
gttgatggaaaagtgcacaggttgaagatacatagagtcaaacctgaagatgctactgat
tacacagtcaaggttggagacagacagacaacagctaaactcagtgtcgatgttattcca
ttaaaattcactgtgcctttgaaagacaaatcagtcaaggaaaaggaagatattacattg
gaggttgaattatctagagatgatgttgatgtcacttggttgctagataaggatgaaatt
cagcctgatgaaagacataacattgaggttgatggcactataagaaggttgacaattcac
gatgccaagcctgaagattctgccaggtacacggtgaaagccaaagataaatcgacctca
gctaggctgaaagttgaggaaatcccagtcaaattcacagtgccattaaaagatcaaaca
gtgaaggagaagagtgaagtcactttggaagttgagatatccagggatgatttggaagtt
tcatggttaatggacaataagaagatcgaacctgatgaaagacatgaaatctttgctgat
ggtgctaaacacaaactggtcattcatgatgccaagccacaggactctgctaaatacaca
gtcaaggcaaaagacaagtctacctctgctaggctcaaagttgaagaaataccattcaaa
tttaatgttcctctcaaggacaaaactgccaaagaaaaggaggatgttactctggaagtt
gagatgtctagggatgatgtggaagtgacatggcttatggacaacaagaaaatagagcca
agtgaacgacatgagattgtagttgatggcaaaataagcagactcatcattcatgatgcc
atacctcaagattcagccaagtacactgtaaaaactaaggacaaaatgactaatgccagg
ctcaaagtggaagaaattcctcttaaatttaccactcccctgaaagacaagacagtcagt
gagaaagaagatgttaccttggaagctgaattatcaagagatgatgtcgaggtcacctgg
ttaattgacaataaaaaggttgttcctgatgagagacatgatatagaggttgatggcaca
gtacacagacttatcatccatggtgcaaaaccagaagactctgccaaatatactgtcaaa
gccaaggacaaggctactacagctaaactgaaagtagaagaaattcctctaacgttcaca
gttcctctcaaagacaagactgtccaagaaggggaagatgtgacattggcagtagagctc
tctagagatgatgtagaagtcacatggctcattgacaataagcagataaaaccagatgac
aggcatgatatttctgcagaaggcaaaatccgaaagcttgtcgtacatggagtccaacct
caggactcggccaagtacactgtcaaagcaaaagacaaatctacctcagccaaaatcaaa
gttgaacaacttgaagtggagttcacacaacctttgaaggacctcactgccaaagaaaat
gaagaagtcacatttgaatgcaaggtttcccaggaaaaccttgatgctgcctggtacttt
ggtgatgtgaaactcaaatcagatgaaaagcatgacatcactgtagagggaacaatacat
aagatgaaaatcaaagatgtctcatctgatgattctgcctcatacacaatcaaaatagcc
gacaaatctagctcagctaaactgtcagttgaagaaattgaggtggaatttgttgtacca
ttgaaagataccactaccaaagaacagacaagtgtgacatttgaatgtgagctcaataaa
ccagtggatgttacctggcttgtggatgggaccgaaattacctcaaatgagaagtatgac
ataactgttgagggcaaagtgcatagattgaccatacacggtccttccataacagatgct
gttgagtatacagtgaaagcagggaacaaaaccagcacagccaggctgactgtagaagaa
atcgatgcagaattcacagttcgcctgaaggaccaacatgtaaaagagtctgaaactgtg
acgtttgaatgtacagtcaacaaaccaaatgtaccagttgcatggtatatgggagacatt
gatttgacatcaaatgagaaatatgagattacagttgatgggaatgtacatcgcttgaca
atccatgatgcccagcccgatgatgctgccatctttactgcaaaactacccaaagaaagg
tgctctgcgaaactgaaagtagaagaaattgctgctgagtttactgttggtcttcaggat
accaaggtcttggagaaagaaacagtagaattcacatgcaaactgtccaaacccacccca
gtacattgggagaaaaagggcaaagaaatccaagatggtggcaggtatcagatcagcgca
gaaggtgttgatgtaaatctgactataactgatgcacagttggatgatactgctcagtac
agctgtgtgctgccatctggagacaaaaccacagccaaacttacagtgaaagaagcacca
tttgaaatcatgaagcccttgtcagatgtcacatctccagtcagaggcacagttaccttt
gaatgtgaggtcaacaaaccagacaagacagcaaggtggcagaaaaatggacgagctatc
aagcatggtggcaagtttgctattagtgtggatggaactacacacactctgacaatacaa
gatgtctccttggaggaggaagcagaatacacagtcatcatagaagataagaaatcttca
gccaaacttttcgtagaagaaatagcagtagaattcacaaaagagctagaggatacaacg
gttactgaaatacctggctctgcagaatttgagtgcgagctcaaccaaccagatgtcccc
atccagtggctgcaaggtgacaaacctctgagacccagtgacaaacacaagatggtctcc
gagggccctgtccataagctgctggtcaaggaggtggatgatgaagatgatggggattac
tctgtggtagccaaagacaagaaatcaactgctaagttgtctgtagaagttcctccgcaa
gccttccttgatgagaagttccaagatgtcttcaccatcaaggcaggtaaatctgcaatt
ttcgaagttccattcactggtgctccacaaccctctgttaactggacattccaacagggg
gcgcttgaaccagccaggatgaaggtggagaccatccgtaacatgacatgcttgacggtc
aacagggcgataagacaagatgctggaaactatgaacttaccctggagaatccatttgga
aagtccactgtcactatcaggctaaatgtactagacaaaccatccccaccacgtgagctg
acagtcgcagatgtcaccagcagctctgtcactctcacctgggaagaacctgaggacaat
ggtggaagtgacatcactgggtacatcatagagaaacgtgatgctaaacgtcagtcatgg
caaaaagtcgatgttgtcaagaaacgagagcttgaagtcactaatttgatcgagggtagt
caactttacttccgtgtaatggcacagaatgaccaaggtgtcagtgagccagtgactctc
aaagaaccagtactaatcaaatgcccatatgacaagccaggtaaaccaggcactcctcaa
tgcacagacatcaccaaaaattcagtgactctcaactggagtcccccacagtctgatgga
ggcagccccattaccagctatgttgtggaatacaagggtgctggagtgttcaagtggacc
acagcaaatacagaacctgtccctgatacttcatacacagtgaccagactgagcgagggg
aaagactatcagttcaggatcagtgcagagaataaggctggcattggtcccccatctgat
gccacagataccattaatattaaggagccagttgttggcacacctccagtcctggtggag
ggtatgcatgacgtgactgcagtggtacctgaggaagctctactggaggcagatattgcc
cctggtgaacctgaagctgagattagatggttcaaagatggcaagcagattgctcccagc
aagaaatatgagatgaactatgtggatgaagtggctgagctagtcattaaggagaccagt
actggagatgctggaaagtacagatgtgaagcaagcaatgccattggaaaggtggacact
gaagcctctctgaccgtacatgtggcccctcacatcacctatgacaacaagtaccaaggg
cctcagaccctgaaatctggatccacactcagcctgaaggtggaagtgagtggcaccccc
acccctactatctcttggcttctggatggggagcccatggagaaatcagcagctgttgcc
atagaaactactgataccacatctggcctccgtgtgaaaaatgttgttgcagatgattct
gggaagtacagggtggtcgcagagaatgttgttggtcaagcaactgctgactttgaagta
atcattcaaggcaaaccatccccaccgaaaaaccttgaagtgacagattacaataaagac
tccatcacagtgaactggcaacccccagagaatgatggtggttcacctatcaaaacctac
atcattgaaagaaaagaaaccaggaagacttcatggacaaatgctggaaaggttgatgga
aataccttgaccttcacccttacgaggttacttgaaggtcaggagtacactgtacgagtt
tcagcagagaatgcaattggtgtcagtgaacctgtagagttaacacaacctgttacagct
aaactgccttatgatgtccctggcactcctacaaatctccaggcaatggaggtagacaag
aacctgattgccctccagtggcaggctccagagtcagacggtggctcccccataactagc
tatgtcattgagcgccaaatgggcaccaggacgacctggaccaaggttaacaaagagaac
accctggagaccacattcaaagttcatgacgtcatagagggcactgagtataatttcagg
gtgtctgctgagaacaaagctggagtagggaagccatccaacaccactggcaaaatcaag
gcagtgacaccaaaagttgctgttgagtttacaactccactgtcagaagtcacagtcaag
tcaggagagacagccaccttacagtgtgaggtcaacaaaccaaatatggatgccaagtgg
ctcaaagatggcaggccaatcaaaagtggtggcaggtttaaaatcattgtagatggcaca
gtacacagtctggtgattgctagtgcagaacaggcagatgaagcacagtattctgtgaag
attgacgacaaaacatcagctgctctgctttcagttgaagaagagaagatagatttcatc
agaacccttgaggatgtgacagtaaaagagatcccaggaactgctgtctttgaatgtgaa
ctgactacctccacccaagtacagtggatgcatgataacaaacccatcacaccatcaaag
aagtacagcataagtgtagatggcaccactgtccacaaattgaccattaatgaagcagat
gatgaggatgagggagagtatagcattgcaatcaagggcaagaaatcaactgctaactta
cacgtgcaagctcccccactgatcagggtggataaatcacttgaagagacagtgacacta
aaggcagggtcatctaaagtatttgagatcccattcactggccatccccagccaaaggtc
agctgggcattcaatgatggacccttgcctgatgagaaaaggttcaaagtggagacaatc
cgcaacatgacttgcctaagagtgacgaagatccagaggaaggagacaggcagatacgct
gtcaccttggacaaccccagtggaaagactgacatcaccatcaatgtgaatgtactagac
aaaccctcacctcccagggacctcaaagcagcagaggtgtccagtcaagaggtcactctg
aagtggacagaaccagaggacaatggaggatgtgatatcacaagctacctcatggagatg
aaggaagtgaccatgagggcatggaaagatgctgggcagactccagacctggagctcact
gtccctaggctgaagaaagacaccaagtacactttccaagtccgtgctaagaatgaatgt
ggtgtcagtgaacctgttgaaatcaaacaacctgtgctggccaaggatctgtttgtaaaa
ccaggcaaacctggcaagccagaggtcagcgacatcacaaaatcttctgtgaccttgacc
tggactgagcctgaggatgatggtggtgcaccaatcagcaactatgtcattgaatacaaa
atgaagagcagtgtcaggtggaccaaagtaccagaaaaggtgtcagataccactcacaca
gtaacagggctcaaggaagactcagaatatgaattccgtgtctctgctgaaaacaaagct
ggtgttggagagccatcaccagtgtctgaacctgtcatcgtcaaggaacctgttgttggc
acagctccagaacttctcagcccaatgtctgatgtgacagcagtgatgcctgaaaaggct
gctctgtcatgtgacatttcacttggagaaccagaggctgaaattacatggtttaaggac
aacaaagagatcaaatcagggaagaagtatgaaatcagctatgctgaggaagtggctgca
ctggtcatcctggagacagacctcaaggacagtgggcagtacaggtgtgaggtagccaat
aagatagggaaagtgaccacacaggctaaattgacagtacaagctaaaccagagttgaag
tatgacaaatcacaactgtctaagagtctacaagaaggggagaccctcactttgagagtg
gagttctctggagaacccaaaccccagatttcttggttattagatggtgaaccagcagac
agtgtgacagtcaaaaccacagatactatgtccactgtaacagtgaagaaggtcaaggct
gaagatgctggtcagtacactgttgtggcagagaaccccgcaggaaaagaagaggttaac
tttgaagtcaatatttcaggcaaaccctctaaacccaaagacttagaggtaacaagttat
aacaaggatagcatctcagttgcctggcaaccaccaactgatgatggaggctcccctata
acaaactacatcattgagcgcagggatgccaaccgagctacatggaccaatgctggtact
gtagatggcagcacctgtatttttacagttggaaaactggtggagggtaatcagtactat
gttagagtatcagccaagaacaaaattggcactggagagcctgtggagctcatggaacca
gtgactgccaaattaccatttgatgtaccagatgcacctactgaccttactgccaaagat
atcagcacgaaggaactcactctcgagtggaaagcaccagaaaaagatggtggttcaccc
atcactggatacatcatagagtgcaggcaggctcgaagttctcgttgggttaaagtgaac
aaaatgccagtcacaaagacaacatacaaggtgacagatctgattgagaacaatgagtac
gagtaccgtgtctgtgcagaaaatgcagcaggtcttagcaaaccatctgaaactacaggc
aacattgttgccaaggtgccatttgttccaattaaatttgtcacacctctcactggacag
tcagtgaaagagggcgaaactgtcaccatggaatgtgagatcaataaacccaaccagaaa
ccacagtggcttaagaatgacacacctatcaccccaagtgaccgctacaccatgaaatct
gatggaaataaacacaaactgaccatcactgatgtccagcctgatgatgctggtaacttt
actattaaagtggaggaccagacatctgatgctactctcgaggttgaggctgaggacttt
gaatttgtggtgcccctgaaggacataactgtcaaacagatcccaggagttgcagtgttt
gaatgtgaaatctccagacctgtggacatagcatggctaagaggagggaagattgtcacc
ccatctgagaaatataagattgagaaggatagtaagagagttaagcatactctcaccatc
aaagatgtggatggagaggatgagggagagtatgctctgtctgcaagaggaagacagtca
aaagcgacccttacagtggcagctcaacctgttatcctgtctgaggagtcctatgaggag
gcaatcaccctgaaaacaggagcctctgcagtgtttgagatccccttctctggcaaccct
caacccacagttacctggactttcaatggtgcctcactaactaagccagccaaggaggaa
accatcaggaatatgacagcactcaccctgaccaaggtgaaaagatcagactccggggag
tacatgctgaagttggaaaatgccagtgggaaagcaagcataactatcaaggtggtggtg
ttggacaaaccaggtcctatccatgacctgacttctccagaggccacatcaaattccatc
tccttgaaatgggctgagcctgaagacgatggaggaagcaacatcatcagatacatcatt
gaaaaacgtgaacaaactcgtagaacatggcagccagctggatcctcaacagagaccgag
ttcactgtcactaatctggttgagaacaacaaatatgtcttcaaggtcagtgcggaaaat
gcacaagggactggaccagcagttgaaatagcacaggctgtattagcaaagagttctttc
gttgtccctagtgcgccagcagctccaaccatctcagacatctttaaagattcagcagtt
gtctcatggcaaccacctagcaaagatggtggctctccagtcattggttatctccttgaa
cgctgtgccgcaccaggtgtcaggtggattagagtagtccatgatgccattgaggagaca
actttcaaggccacagacctgatggagggcagtgaataccagtaccgagtcatagcagtc
aacaaagcaggagagagcaagccaagcgaggggtcttcacctttcaaagccaaggaccca
tgggacaaaccaggtaaacctggctccccagaggttgaagaaatcacatcttcaactgtc
accctgtcatggtcaccaccaagcaatgatggcggcagcccaatcctgaactacattgtt
gaatacaaagccaccgaggctttccgttggctgaaagccacagaggagaccgtggcagaa
accaaattggttgtggagaagctgagagatggagatagctatgagtttagagttagtgct
gagaacaaagcagggacaggaccaccatctgaagtgtcccgtgctgtgactgtccgagag
cctatcagtggggaagcacctgaactggtggaaaaaataacagacatggctgtaatttcc
cctgagccagccaccctgaagtgtaagatctcaccaggagagcctgagcctgaaatcaag
tggtttaaggagggcaaggaactccagacagatggaaaatacaagactgagtataagaac
aacactgccaccctggttataaatgatactgaacctgctgatgctgggaagtacaagtgt
gtggccaccaatgccttgggcaaagtggagagtgttggagaactcagggtacaagtgcct
cccaaactagagtatgacaacaaattgcgtgaacctctgaaggtgaaggaaggaggatca
gccacgctttcagtggacatagatggcgttccagaacccaagatcacatggttacacgat
ggcaaaccagtggagaagtctcacagacttacagtacagacaagagatggaacatcaaca
ttaaatctcaaaggactgacaaaagaagatggcggaaaatattctgttgttgtagaaaat
gacgtgggcaaagacacagcagactttgaggtcattattacaggaaaaccctctgctcct
acaaatcttcaagtgaaagaaaccaataagaattacatcactgtcacctggcaaccacca
gaaagcgatggtggctcccctatcaaagagtacataatcgaaagaagagatgcctccaga
caaacttggacacaggcaggaactgtaggtggcagcacatttgaattcatgattaccaaa
ctactggaaggcaacaagtattacatccgtgtatctgccagtaaccaactgggcactggg
cccccagcagagctcaaggaaccagtcacagctaaggttccattcgatgtaccaggaccc
ccagtaaaccttgaagtgtttgaagtgagcaagtcacacataacccttgcatgggatgcc
ccagagaatgacgggggtgctgacgtcaaaggttacgtcattgagcgtcgtgtggcaacc
agtactaaatggatcagaatcaatagaaagctggttgacgatatagaatatgacatcact
gatgtcagggaaggtgtggagtattgtttgagggtgttggcagagaatgaggctgggctg
agtcagccctctgaggagctgggaccagtgctggtcaaagagccattcgatcccccagat
gctccagctgcacctgaggtgactgacatcacaaaacgtacagcaacactgaagtggtca
accccggaaaaagatggtggcagccctgtgacagggtacgacatcgaggtcaaatctact
gtgaagttccgctggaccagccttaacttgaaggaaccagacacagtgtacacagtgaaa
gatctgcagccaggagagaagtatgagttcagagtagttgctgaaaacaaagctggccgc
agtcagccatcatcaccttcaagacagattgtggctgaggacagaacaactggagaggct
cctagagttgtggaacaattgaaggatgttgccgcagctgttggagggacaactaaactg
gagtgtcagatatttggatctccagaacctcaagttaaatggaaaaagaacaacagagaa
ctgttaccaggcaggaaagtggccatgagctatgtggacagtgtggccacattgaccata
ctggacaccacagactctgatgctgggaagtatatatgtgaggcgtctaacactttggct
ttggtatcaacatcatgtgcagtctcagtgaatgttccaccaacaatcaatcttgaccgc
aaattgcgcgatggtcagtccattaagaccggtggcagcctcaagatgtctgccaacatt
ggtggctccccagtacctgaagtggtttggctcaaagatggtgaaccagttgttccagat
ggcagagtagtgatagagaacactgactccacgtcatctctgaccataagaaaagccaag
ttggatgatgatggtgaatatacccttcagctgaagagcccagctggggaagcctctgct
actatcgatgtagaggtggttgataaaccccaagctccagctgacttcaaagtgaccaac
gtgtccaaggactctgtaagcctagagtggaccaagcctaaagatgatggtggtaaagag
gtgacatcgtatatcattgagagaagagatgccaagagaccatcgtggatgaaggttaca
agtgtcccagcctccaagttcagttacactatccctaacttgatcgaaggcaatgagtac
ttcttccgtgtgtcagcagtcaatgacataggcactggagaacctgccgaactggacttg
cctgtactggtcaagagtgcatttgaaaaaccaagcactcccaagggccctctggtcctg
aaggaacctcacccaggactcagttacactacagtggcagccagcagatggcactgttct
gaaatatgtggtagaaaaacgagactccaggcgctacagttggtcagaagttga

DBGET integrated database retrieval system