KEGG   Lingula anatina: 106180649Help
Entry
106180649         CDS       T04921                                 

Definition
(RefSeq) threonine synthase-like 2 isoform X1
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
lak  Lingula anatina
Brite
KEGG Orthology (KO) [BR:lak00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106180649
Enzymes [BR:lak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     106180649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP DUF3141
Motif
Other DBs
NCBI-GeneID: 106180649
NCBI-ProteinID: XP_013420133
UniProt: A0A1S3KBX2
Position
Unknown
AA seq 506 aa AA seqDB search
MKKEGRLQIEKVYHSAMLIAISKSPRMAYTNMRYNSSRGQINDFTFEEALFSGFTSDGGM
LMPDEIPKVTSDQIRHWSKLSYTELVKEVVALFVPEEEVPREDQSSLIDKAFSRFTHPDV
VNIAKLKNGLNILELFHGTTLAFKDLAMSCVGQFFNYFLKKKERHMVVLVGTSGDTGSAA
IEAMRGLEAVDIVVMLPKGRCTRIQELQMTTVIEDNVHVYRVDGTSDEIDEPLKNCFTDA
AFAQENNLCSVNSINWCRIMVQIAHYFYAYFQLCPGCDDTVEIAVPTGGCGNITAGCLAW
FMGLPIEITVTVNRNDIMYHICTEGKLKMPSTMTPSLAPAMDIQNPYNMQRILYMLSNSN
GKLVKEIMETFEAGREAVIPDDVFKKMKKIVTKSFVADDDLIKSAMARCWKENQYLLCPH
TAVAAAYHYNTLVNSDVIPKRVCIATASPAKFPEAVTLAGLTPQPTPEIAALETKPTRYI
DMNKGEDWTGILKEKIKEISQKRRSY
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggagggtagattgcagattgagaaggtgtatcattcagctatgctaatagca
attagcaagagtccccgcatggcatataccaatatgaggtacaacagttcaagaggccag
atcaatgacttcacatttgaggaggccctgttctctggattcacaagtgatggagggatg
ttaatgccagatgaaattccaaaggtaacttcagatcaaatcaggcattggtcaaagtta
tcctatacagagctggtaaaagaggtggtagcattgtttgtacctgaagaggaggtacca
agagaggaccaaagcagtttaatagacaaagcatttagcaggtttacacaccctgatgtt
gtaaacattgccaagctaaaaaatggtttaaatatccttgaactttttcatggcacaaca
cttgcatttaaagatttggccatgtcttgtgttgggcagtttttcaactactttttgaag
aagaaggaaagacacatggttgtgcttgtcggcacctctggagatacaggtagtgctgcc
attgaagcaatgaggggtctggaagcagtggatatagtggtcatgctgccaaaggggaga
tgtacccgtatacaggagctgcagatgactactgtaattgaggataacgttcacgtgtac
agagttgatggcacatcagatgaaatagatgaacctttgaaaaactgtttcaccgatgca
gcctttgcccaagaaaataatctgtgtagtgtcaactcaatcaactggtgccgcatcatg
gtgcagattgctcattatttctatgcatatttccaactgtgcccaggttgtgatgataca
gtggaaatagctgtccctacaggaggctgtggcaacatcacagctggctgcctcgcatgg
tttatgggccttcctatagagataacagtaacagtcaatagaaatgatatcatgtatcat
atatgtacagagggaaagcttaaaatgccttccacaatgaccccctctcttgctccagcc
atggatattcagaatccatacaatatgcagagaattttgtacatgcttagtaacagtaat
ggaaaacttgtcaaggaaataatggagacttttgaggctggtagagaagcagttatacca
gacgatgttttcaaaaaaatgaaaaagattgttacaaaaagttttgttgctgatgatgat
ttgatcaagtctgcaatggcacgttgctggaaggagaaccagtatctgttatgtccacat
actgctgtggctgctgcctaccactacaacactctggtcaattctgatgtgatacccaaa
agagtatgcatagctacggcatctcctgccaagttcccagaggcagttacattagctggc
ctcactccccagccaacaccagagatagctgccttggaaaccaaaccaaccaggtacata
gacatgaataagggagaggactggactggcattcttaaggagaaaattaaggagatcagc
caaaagagaagaagttattag

DBGET integrated database retrieval system