KEGG   Lacimicrobium alkaliphilum: AT746_01740Help
Entry
AT746_01740       CDS       T04189                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lal  Lacimicrobium alkaliphilum
Pathway
lal00010  Glycolysis / Gluconeogenesis
lal00053  Ascorbate and aldarate metabolism
lal00071  Fatty acid degradation
lal00280  Valine, leucine and isoleucine degradation
lal00310  Lysine degradation
lal00330  Arginine and proline metabolism
lal00340  Histidine metabolism
lal00380  Tryptophan metabolism
lal00410  beta-Alanine metabolism
lal00561  Glycerolipid metabolism
lal00620  Pyruvate metabolism
lal00625  Chloroalkane and chloroalkene degradation
lal00903  Limonene and pinene degradation
lal01100  Metabolic pathways
lal01110  Biosynthesis of secondary metabolites
lal01120  Microbial metabolism in diverse environments
lal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT746_01740
   00053 Ascorbate and aldarate metabolism
    AT746_01740
   00620 Pyruvate metabolism
    AT746_01740
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT746_01740
   00561 Glycerolipid metabolism
    AT746_01740
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT746_01740
   00310 Lysine degradation
    AT746_01740
   00330 Arginine and proline metabolism
    AT746_01740
   00340 Histidine metabolism
    AT746_01740
   00380 Tryptophan metabolism
    AT746_01740
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT746_01740
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AT746_01740
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AT746_01740
Enzymes [BR:lal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AT746_01740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALS97126
UniProt: A0A0U2JI84
Position
369654..371183
Genome map
AA seq 509 aa AA seqDB search
MEFLKKLGISAENAGVSTGTGWLDKSDSAPIAIHSPVDGRLIARVTPCSQQQYHQVVEKA
HSAFLQWRQVTAPQRGEIVRQIGEALREYKQPLGELVSYEMGKSLQEGLGEVQEMIDICD
FAVGLSRQLCGSTMHSERPLHRMYEQYHPLGVVGVISAFNFPVAVWSWNTMIAAVCGDAV
IWKPSEKTPLTAIACQNIVQQVLVRNHLPEGLLSMVVGGPEIGELMLDDKRLPLMSVTGS
TRVGRHAGQKVAARFGKSILELGGNNAIIITANADLKVAVPGVVFGAVGTAGQRCTTTRR
VIVHESVYDKVKESLVSAYGKLRIGDPLDENNHVGPLIDKDSVSNFVNAISRVRDEGGTL
LCGGEVLQGKGYESGCYVTPAIVEAENHYDTVQSETFAPLLYLIKYKGELEEAIALQNGV
AQGLSSAIFSLDMREVENYLAHWGSDCGISNVNIGTSGAEIGGAFGGEKETGGGRESGSD
AWKVYMRRQTNTINYSTELPLAQGIKFDL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggagtttctgaaaaaattaggtatcagtgcagaaaatgccggtgtcagcaccggaacc
ggctggctggataaaagtgacagcgcacccattgcaatccattcaccagtcgatggccgt
cttatcgccagggtaacgccttgttcgcagcagcagtatcatcaggtggtggaaaaagca
cacagcgcatttctgcaatggcgtcaggtcaccgcgccacagcgaggcgagattgttcgc
cagattggtgaagcgctgcgtgaatataagcagccactgggcgaactggtctcctatgaa
atgggtaagtcgttgcaggaaggcttaggtgaagtacaggaaatgatcgacatctgtgac
tttgccgtgggcctttcccgccagctttgcggctcgaccatgcattccgagcgcccattg
caccgtatgtatgagcaatatcatcccctgggtgtggtcggtgtgatttctgcttttaat
ttcccggtggcggtatggtcatggaacactatgatcgctgcggtatgtggtgatgcggtg
atctggaaaccatcagagaagaccccgctgaccgctatcgcctgtcagaacattgtgcag
caggtactggtccgcaatcatctgcccgaagggttgttgtctatggttgtgggcgggccg
gaaattggtgagctgatgctggatgataaacgcctgccactgatgtccgtcaccggctca
acccgggtcggccgtcatgcgggtcagaaagtggcggcccgttttggtaagagtattctc
gaactgggtggcaacaatgccatcattattactgccaatgcggatcttaaagtcgctgtg
cccggcgtggtgtttggtgcggtaggcacggcgggtcagcgctgtaccaccacccgcagg
gttatcgtacatgagtccgtgtatgacaaggttaaggaatcgctggtcagtgcctacggc
aaactgcgcatcggcgacccgctggatgaaaacaatcacgtcgggccccttatcgataaa
gactcagtgagcaactttgtcaatgcgatcagccgtgttcgtgacgaaggcggcacgctg
ctgtgcggcggtgaagtcttgcaggggaagggttatgaatccggctgttatgtgaccccg
gcgattgttgaggccgaaaatcactatgacacagtgcagagcgagacctttgcgccgctt
ttatacctgatcaaatacaaaggtgaactcgaagaggcgattgcactgcaaaacggtgtg
gctcagggcttgtcatcggctatctttagtctggatatgcgcgaagtggagaactatctg
gcccattggggttccgattgcggcatttctaatgtcaatatcggtacttccggtgcagaa
attggtggtgctttcggcggtgaaaaggaaaccggcggtggccgtgaatccggctctgac
gcctggaaagtctatatgcgtcgacaaaccaataccatcaattactctaccgagttgccg
ctggcacagggcattaagttcgacctgtag

DBGET integrated database retrieval system