KEGG   Lacimicrobium alkaliphilum: AT746_05345Help
Entry
AT746_05345       CDS       T04189                                 

Definition
(GenBank) hypothetical protein
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
lal  Lacimicrobium alkaliphilum
Brite
KEGG Orthology (KO) [BR:lal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lal03016]
    AT746_05345
Enzymes [BR:lal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     AT746_05345
Transfer RNA biogenesis [BR:lal03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    AT746_05345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ALS97755
UniProt: A0A0U2QKJ2
Position
1183758..1184495
Genome map
AA seq 245 aa AA seqDB search
MLPVLYQDDYMIAVHKPAGLLVHRSLIDKYETRFAMQMVRDQLNQHVFTVHRLDKPTSGV
LLFALNRDVARLLNPMFAEGKVEKTYRAIVRGFSPPGGRIEHALKEKLDAIADKKVRTDK
EPQSAISEYKTRARFELPFAVRPYKTARYSLVELHPHTGRKHQLRRHMAHINHPILGDAN
HGDGKHNAMLRTEFDFQGLALNASEIALNHPVSGQKLVIKSESEPRMQRLLTLWRDNNWE
RECPE
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgctgccggttctctatcaggatgactatatgattgcggtgcacaagccagccgggttg
ctggttcatcgtagtcttattgataaatatgaaacccgttttgccatgcagatggtgcgt
gatcaattaaatcagcatgtgtttaccgtgcatcggctggataaacctacctccggcgtg
ctgttgtttgctctgaatcgcgatgtggcaagactgctcaacccgatgttcgcagagggt
aaggtagagaaaacctatcgtgctattgtcaggggtttcagcccaccgggagggcgcatc
gagcatgcactgaaagaaaagcttgatgccattgcagataaaaaggtccgtactgacaaa
gagccacagtctgcaatcagtgagtataagacaagggcacgttttgaattgccttttgct
gtgcggccatacaaaacggcccgctattcactggtggagcttcatcctcataccggccgc
aagcatcagttacgccgccatatggcgcatattaatcaccctatcctgggggatgccaat
catggtgacggcaagcacaatgccatgctcagaaccgaatttgattttcagggactggca
ttaaacgcatctgagatagcgcttaaccatccggtaagcgggcaaaaattagtgatcaaa
tctgagtctgaaccacgtatgcaaagactcctgaccctttggcgagacaataactgggag
agagaatgtccagagtaa

DBGET integrated database retrieval system