KEGG   Lacimicrobium alkaliphilum: AT746_05795Help
Entry
AT746_05795       CDS       T04189                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
lal  Lacimicrobium alkaliphilum
Pathway
lal00360  Phenylalanine metabolism
lal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lal00790  Folate biosynthesis
lal01100  Metabolic pathways
lal01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AT746_05795 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AT746_05795 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AT746_05795 (phhA)
Enzymes [BR:lal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     AT746_05795 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ALS97831
UniProt: A0A0U2ZFG4
Position
1279156..1279956
Genome map
AA seq 266 aa AA seqDB search
MSKTTQYVSRQSDEKGIIHWSDEENAVWRDLVARQLEIIQDRACDQFMHGLELLDLPADR
IPQLAEVNKVLERETGWQVAEVPALINFDEFFRLLANKRFPVATFIRTREEFDYLQEPDI
FHEIFGHCPLLTNPAFAHFTHTYGKLGYAASKQDRVYLARLYWFTVEFGLLRQQGDLRIY
GGGILSSPGETLYALESDKPKRYEMDPVEALRTPYRIDIMQPVYYVLDNLDALFEIADMD
MMALVEKAKALGLHKPRFPPKEKMAS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaactacccagtacgtatcacgtcagtcagacgagaaggggattattcattgg
agtgatgaagagaatgcggtctggcgtgatctggttgcccggcaactggagattattcag
gatcgcgcctgtgatcagtttatgcacgggctggagttacttgatctgccagccgacagg
atcccgcaactggcagaagtaaataaggtgctggaacgtgaaaccggctggcaggtggct
gaagttccggcactgatcaatttcgatgaatttttccgtctgctggcaaacaagcgtttc
ccggttgcaacctttatccgtacccgggaagaatttgattatctgcaggagccggatatt
tttcatgagattttcggtcattgccctttgctgaccaatccggcctttgcccatttcact
catacatacggcaagctgggatatgcagcaagtaaacaggacagagtgtatctggcccgt
ctgtactggttcaccgtggaattcggtttattacgtcagcagggtgatctgagaatctat
ggcggcggtattctgtcttcaccgggtgagaccctgtatgcactggaaagtgacaaaccc
aagcggtatgaaatggatccggtggaggcgctgagaaccccttaccggattgatattatg
cagcccgtttattatgttctggataacctcgatgccttatttgaaatagcggacatggat
atgatggcgctggtagaaaaagccaaagcgctgggcctgcataaacccaggttcccacct
aaagaaaagatggcaagttaa

DBGET integrated database retrieval system