KEGG   Lacimicrobium alkaliphilum: AT746_09200Help
Entry
AT746_09200       CDS       T04189                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lal  Lacimicrobium alkaliphilum
Pathway
lal00480  Glutathione metabolism
lal00590  Arachidonic acid metabolism
lal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AT746_09200
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AT746_09200
Enzymes [BR:lal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AT746_09200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ALS98417
UniProt: A0A0U3AI86
Position
complement(2015725..2016222)
Genome map
AA seq 165 aa AA seqDB search
MTESLYDFEVEKIDGNKQSMADFSNKVLLIVNTASKCGFTPQYEGLEQLYRDYRDKGLEI
LAFPCNQFGGQEPGSEEQIQQFCDLNYQTSFPLFKKVDVNGDQAEPLYNYLKDKARGVLG
SKSIKWNFTKFLVDKQGNVVRRYGSTTKPDEIRQDIEALIAGESI
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaagcctgtacgacttcgaagtggaaaaaatcgatggcaacaaacaatctatg
gcggacttcagcaataaagtgctgttgatcgtaaataccgccagcaaatgcggctttacg
cctcagtacgaaggactggagcagctttaccgggattaccgcgataaggggctggagatc
ctggcctttccctgtaatcagtttggcggtcaggaacccggctctgaagaacagatccag
caattctgcgatctaaactaccagaccagctttccactgtttaaaaaagtggatgttaat
ggcgatcaggccgaacccttatacaactatcttaaggacaaggcccgcggtgtgctgggg
agtaaaagtatcaagtggaacttcaccaaatttttagtagataaacagggaaatgtggtc
agacgctatggctctaccaccaaacccgatgagatcaggcaggatattgaagccctgatt
gccggtgaatccatttag

DBGET integrated database retrieval system