KEGG   Lacimicrobium alkaliphilum: AT746_13585Help
Entry
AT746_13585       CDS       T04189                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
lal  Lacimicrobium alkaliphilum
Pathway
lal00620  Pyruvate metabolism
lal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AT746_13585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lal02000]
    AT746_13585
Enzymes [BR:lal01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     AT746_13585
Transporters [BR:lal02000]
 Other transporters
  Primary active transporters [TC:3]
   AT746_13585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 PTS_EIIA_1 GCV_H
Motif
Other DBs
NCBI-ProteinID: ALS99189
UniProt: A0A0U3BBZ9
Position
complement(2997697..2999478)
Genome map
AA seq 593 aa AA seqDB search
MSNPLAITDVVLRDGHQSLLATRMRLDDMLPIAEKLDAIGYWSLETWGGATFDACIRYLG
EDPWDRIRQLKKAMPNTKQQMLLRGQNLLGYRHYADDVVRKFVERAHTNGVDVFRIFDAM
NDVRNLQTAVKSAVEVGAHAQGTLSYTVSPVHTMDMWINMARQIEDMGVHSICIKDMAGL
LKPYTCEELITKLKEAVAVPITMQCHATTGLSTATYQKAIDAGIDMLDTSISSMSMTYGH
SATETIVAMVEDTERDTGLDLIKLEEIAAYFREVRKKYAKFEGSLKGVDSRILIAQVPGG
MLTNMENQLREQGAEDKMDEVLKEIPSVREDLGFIPLVTPTSQIVGSQSVLNVLTGERYK
SITKETAAVLKGEYGATAAPVNKELQTRVLEGGEPITCRPADLIDDEMDKLSKELKDVAK
EEDIELAKDTVDDVLTYALFPQIGLKFLQNRGNPDAFEPAPDGSTQTSTPTSSGSAKKGP
ATYSVRVDGKVFSVEVAESGELTDISEAPQADKQQPQKTSVDGTETLNAPLAGNIFKLLA
KPGEQVSKGDVVLIMEAMKMETEVRAAHDGVVAEVLVGEGDAVQSGQPLMTLG
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatccacttgctattacagatgttgtactcagggacggtcatcagtctctgctg
gccacgcgtatgcgccttgacgatatgctgccgattgcagaaaagcttgatgctattggc
tactggtctctggaaacctggggcggggcaacctttgatgcctgtatacgctacttaggt
gaagatccctgggacagaatccgtcaactgaaaaaggctatgcccaataccaaacagcag
atgctgctgagagggcagaatttgctgggttatcgccattacgccgacgatgtggtgcgc
aagtttgttgagcgggcacacactaatggtgtggatgtgtttcgcattttcgatgccatg
aacgatgtacgtaatttgcaaactgcagtcaagtctgcggtggaagtgggtgcccatgcg
cagggtacgctgtcgtacaccgtcagccccgtacatactatggatatgtggatcaatatg
gcccgccagattgaggatatgggggtgcactccatctgtattaaggatatggccggtctg
cttaaaccctacacctgcgaagaactgattactaagcttaaagaagccgtagcagtgccg
atcactatgcaatgccatgccactacgggtttaagcacagccacttatcaaaaagccatt
gatgccggtattgatatgctggatacctcaatctcctctatgagcatgacctatggccat
tcggctaccgaaactatcgtcgctatggtggaagacactgaaagggataccgggctggat
ctgatcaagctcgaagagatcgccgcttattttcgcgaagtgcggaaaaagtatgccaaa
tttgaaggcagcctgaagggagtggattcacgtattcttattgcgcaggtacccggcggt
atgctgacgaatatggaaaatcagctgcgagaacagggcgctgaagacaaaatggacgaa
gtgttaaaggaaattccctcagtacgggaagatcttggttttattccgctggtgacacct
acctcccagattgtcggtagtcagtcagtactaaatgtgcttaccggtgagcgctataag
agcattaccaaagagaccgccgcggtgcttaaaggcgaatacggtgcgacagccgcaccg
gtaaacaaagagctacaaaccagagtcctcgaaggtggtgagccaatcacctgtcgtccg
gcggatttaatcgatgatgaaatggacaagctcagcaaagagcttaaggatgtggcgaaa
gaggaagatattgagcttgccaaagacacagttgatgatgtgctcacttatgctttattc
ccgcaaataggcctcaagtttctgcagaacagaggtaaccctgatgcctttgagccggct
cccgatggcagtactcagaccagcacgccgacatcttccggtagcgcaaaaaaaggcccg
gctacatactcggtgcgggttgacggtaaggtcttcagcgttgaagtggcagaaagcggc
gagctgacggatatttccgaggcgcctcaggccgacaagcagcaaccgcagaaaaccagc
gttgatggtaccgaaaccctcaatgcgccactggccggcaatatctttaagctgttggcc
aaacccggcgagcaagtcagtaagggggatgtggtgctgatcatggaagccatgaagatg
gaaaccgaagtgcgtgcagcccatgatggtgtggtggcagaagtgttggtcggtgaaggg
gacgcggtgcaatccggtcagcccctgatgacattggggtaa

DBGET integrated database retrieval system