KEGG   Lacimicrobium alkaliphilum: AT746_17445Help
Entry
AT746_17445       CDS       T04189                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lal  Lacimicrobium alkaliphilum
Pathway
lal00071  Fatty acid degradation
lal00072  Synthesis and degradation of ketone bodies
lal00280  Valine, leucine and isoleucine degradation
lal00310  Lysine degradation
lal00362  Benzoate degradation
lal00380  Tryptophan metabolism
lal00620  Pyruvate metabolism
lal00630  Glyoxylate and dicarboxylate metabolism
lal00640  Propanoate metabolism
lal00650  Butanoate metabolism
lal00900  Terpenoid backbone biosynthesis
lal01100  Metabolic pathways
lal01110  Biosynthesis of secondary metabolites
lal01120  Microbial metabolism in diverse environments
lal01130  Biosynthesis of antibiotics
lal01200  Carbon metabolism
lal01212  Fatty acid metabolism
lal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AT746_17445
   00630 Glyoxylate and dicarboxylate metabolism
    AT746_17445
   00640 Propanoate metabolism
    AT746_17445
   00650 Butanoate metabolism
    AT746_17445
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT746_17445
   00072 Synthesis and degradation of ketone bodies
    AT746_17445
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT746_17445
   00310 Lysine degradation
    AT746_17445
   00380 Tryptophan metabolism
    AT746_17445
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AT746_17445
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AT746_17445
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AT746_17445
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lal04147]
    AT746_17445
Enzymes [BR:lal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AT746_17445
Exosome [BR:lal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT746_17445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALS99872
UniProt: A0A0U3B492
Position
complement(3905305..3906507)
Genome map
AA seq 400 aa AA seqDB search
MTQAYIYDAIRTPRTKAREEGELHDLMPYDLLGTLYTALQNRTQLDPELVGDVILGCATQ
AGEQAANIAKTSTLYAGWPGSIPGITVNRYCSSGIDAINMAAMKVMCGMDQLVVAGGVEM
MSRVAMLSDKPRPFMDAKLAARMGMFMMGSGADLIASLHGYSRQEVDAVALLSQQRAAHA
REQGYFKSVVPVTNPVKGCEVTQDKLIREKTSAESLAKMSLAFADMGAKGVDQMMLQAFP
QLEQMTHVHTAGNSPAMADGAAVLLIGSQAAAKQLSQQPRARIVAMKNVNDDTRMVVGGC
VAATRALMAEQGLTSDDIDLFEIHEAFGATILRCKQELEIDDSKLNVNGGCIALGHPLGA
TGAMMAGTLLDELERRNLKTGIVAASGAAGTGTALMIERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagcctatatttacgacgcgatcagaacaccccgcaccaaagcccgtgaagag
ggggaactgcatgatttaatgccctatgacctgcttggcaccttgtataccgctctgcaa
aaccgcacccagcttgatccagagctggtcggggatgtgattcttggctgtgcaacacag
gccggagagcaggcggccaatattgccaaaacctctactctgtatgccggctggccgggc
agcataccgggcatcactgttaaccgctattgctcttcaggaattgacgcgatcaatatg
gccgccatgaaagtcatgtgcggaatggatcaactggtcgtcgctggcggggtggaaatg
atgtccagagtggcgatgttatcggataagcccaggccttttatggatgccaagctggcc
gccagaatgggcatgtttatgatgggcagtggcgctgatttaatcgcttcgctgcacggc
tacagccggcaagaagtggatgcggtggccttgctcagccaacagcgggcagcacatgcc
agggagcagggttactttaaatccgttgtccctgttactaatccggtcaaaggctgtgag
gtcacacaggacaagcttataagagaaaagaccagtgccgaatcgctggcgaaaatgtct
ttggcctttgccgatatgggcgccaagggtgttgatcagatgatgttgcaggcgttcccc
caattagagcagatgacacatgtacacaccgccggtaattctcctgccatggctgacggt
gctgcagttctgttgataggttcacaggcagcagcaaaacagctgagtcagcagcccaga
gccagaattgtggcgatgaagaatgtcaatgatgatacgcgcatggtggtgggggggtgt
gtcgccgctacccgggcgttaatggctgagcagggactgaccagtgacgatatcgatctg
tttgagattcacgaggcctttggcgcaacgatattgcgctgtaaacaagagcttgaaatt
gatgacagcaagctgaatgtcaatggaggttgcattgcccttggtcacccattgggcgca
accggcgcaatgatggcgggtaccctgctggatgaactggaaagacgaaaccttaaaacc
ggcattgttgccgcgagtggcgccgcgggcaccggaaccgcactgatgatagagcgcgta
tag

DBGET integrated database retrieval system