KEGG   Lactobacillus alimentarius: LA20249_05660Help
Entry
LA20249_05660     CDS       T05458                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
lali  Lactobacillus alimentarius
Pathway
lali00072  Synthesis and degradation of ketone bodies
lali00280  Valine, leucine and isoleucine degradation
lali00650  Butanoate metabolism
lali00900  Terpenoid backbone biosynthesis
lali01100  Metabolic pathways
lali01110  Biosynthesis of secondary metabolites
lali01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LA20249_05660
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    LA20249_05660
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LA20249_05660
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LA20249_05660
Enzymes [BR:lali01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     LA20249_05660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_N HMG_CoA_synt_C ACP_syn_III Chal_sti_synt_N SHR3_chaperone Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AUI71698
UniProt: A0A2K9HH38
Position
complement(1184065..1185219)
Genome map
AA seq 384 aa AA seqDB search
MNIGIDKIGFYTPKDYIDIVELAKARDVDPNKFTIGIGQDKQAVPRPYEDAVTMAASSAD
SILTEADKASLGLLIVGTESSVDESKSTAAFLMDLLELPEDIRSFEIKQACYGATAGLQT
AYDFVSQNPDKKALVIATDIARYGIKTPGEVTQGAGSVAMIVSQNPRVLKLNYKSVYMTK
NVGDFWRPTFSKTAFARGKYSNEIYVDFFKTLWEKYQTKYSATIDDFSTLLFHIPYTKMG
TKALRTLEGKIPDDKYAELTEHYQQSIKFSREVGNLYTGSLYLGLLSYLINGARSGEELL
MFSYGSGAVGELYSAEIQKDFASGIVSENVLKMLNERKKMSISDYEKIYQIEYQNGTIVD
PEAVESKFYLSEIKDNERLYKKNK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaatataggtattgataaaataggcttttatactcctaaggattacattgatattgtt
gaattagctaaggcacgggatgtggatcctaataaatttacaattggcattggtcaagat
aaacaagctgtccctagaccttatgaggatgcggtgactatggctgccagttccgccgat
agtattttaacggaagctgataaagcctctttaggtttattgattgttggaactgaaagt
agcgttgatgaatctaaatctactgcagcttttttgatggatcttttagagttaccagag
gatattcgttcctttgaaatcaagcaagcttgttatggagccacggctggtttacaaaca
gcgtatgatttcgtgagccagaatcctgataaaaaagcactagtgattgcaaccgatatt
gctcgttacggtatcaagacgccgggtgaagtaacacaaggtgctggctctgtagcaatg
attgttagtcaaaatcctcgcgtcttgaaattgaactataagtcagtttacatgacaaaa
aatgtgggtgatttctggcgtcctactttctccaagactgctttcgctcgaggaaagtat
tctaatgaaatatatgtcgacttctttaagacactgtgggaaaaatatcaaactaagtat
tccgctacgattgatgatttttcaacgttacttttccatattccttatacaaaaatggga
actaaggcattgagaactttggaagggaagattcctgatgataaatatgctgaattgact
gagcattatcaacaaagtattaaattcagtcgagaggtagggaatctttacacgggttca
ttatatttagggctattatcttatttgatcaatggcgctcgtagtggtgaagaattattg
atgttcagttacggttctggtgctgtcggtgaattgtatagtgctgagattcaaaaagat
tttgcctcaggaattgtctcagaaaatgttttgaaaatgttgaatgagcgtaaaaagatg
agtatttctgattatgaaaaaatatatcagattgagtatcaaaatggtacgatcgttgac
ccagaggctgttgagagtaagttctatttgagtgagataaaagataatgaacgattgtat
aaaaagaataagtaa

DBGET integrated database retrieval system