KEGG   Lactobacillus allii: BTM29_04935Help
Entry
BTM29_04935       CDS       T05413                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lalw  Lactobacillus allii
Pathway
lalw00480  Glutathione metabolism
lalw00590  Arachidonic acid metabolism
lalw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lalw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BTM29_04935
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BTM29_04935
Enzymes [BR:lalw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BTM29_04935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: APX73334
UniProt: A0A1P8Q648
Position
1035774..1036247
Genome map
AA seq 157 aa AA seqDB search
MATIYDFSETEMNGDKIDFNDYKGKVVLIVNTASKCGLAPQLEGIEALYKKYHEQGLEVL
GLPSNQFHQELGSDEETSEYCQMHYGVTFPMTKQVKVNGDDEDALFTYLKETAGHGRIKW
NFTKFLIGRDGQMIERFAPTTKPEKFESDIVSALEDK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggctactatttacgatttttcagagactgaaatgaacggtgacaagattgacttcaat
gattataaaggtaaggtagttttgatcgtcaatactgccagcaaatgtggactagctcca
caacttgagggaatagaagcattatataagaagtatcatgagcaaggactcgaggtacta
ggtttgccgtctaaccaattccaccaagaattgggttcagacgaagagactagtgagtat
tgtcaaatgcattatggtgtaactttcccaatgaccaagcaggtcaaggttaatggggat
gatgaagatgcattgttcacataccttaaagagacagcgggacacggacgtatcaagtgg
aactttaccaagtttctaattggccgtgatggtcagatgattgaacgttttgctccaact
actaagcctgagaagtttgagtctgatattgtttcagcacttgaagacaaataa

DBGET integrated database retrieval system