KEGG   Lactobacillus amylovorus GRL 1112: LA2_00800Help
Entry
LA2_00800         CDS       T01371                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
lam00520  Amino sugar and nucleotide sugar metabolism
lam01100  Metabolic pathways
lam01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LA2_00800
Enzymes [BR:lam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     LA2_00800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ADQ58157
UniProt: E4SK13
Position
157156..158310
Genome map
AA seq 384 aa AA seqDB search
MTYYIHADKFFLENRTENGGYLEVQDNGKFGFFYPESKKPEGKIVDYKGKWVAPGLVDTH
IHGSLREDVMKSDWEGINKISNGLLSAGVTSWLPTTITAGSDTLTRICKMFADHKGQETG
AKIQGIHFEGPFFTEEHAGAENPKYMMDPDINEFNKWRDASDGMLCKISMAPERKGSKEF
IREAVKEGVVISLGHSSATFEEAVEGVEAGATMFTHTFNGMPDPSHHIPSISNAAMALNN
VTDELICDGHHVQPSMAKTLINAVGPEHIALITDCMEAGMMPDGDYMLGELPVYVKDGMA
RLKDGDNLAGSILQLKQAIKNVVDWNIVTPEEAVMMASYVPAKSAHILDKCGTIAPDKDA
DFLILNPDMTLSETYMNGESRYKA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacttattacattcatgcagacaagtttttcttagaaaacagaacagaaaatggcggt
tatcttgaagttcaagacaacggcaagtttggctttttctatcctgagtctaaaaagcca
gaaggtaagatcgttgactacaagggtaagtgggttgctccaggtttagttgatactcac
atccatggttcacttcgtgaagatgttatgaagagtgactgggaaggcatcaacaagatt
tctaatggtcttcttagcgcaggtgtaacctcatggctgccaactacaatcactgccggt
agcgatactttgactagaatctgcaagatgttcgcagaccacaagggtcaagaaactggt
gccaagattcaaggtattcactttgaaggacctttctttactgaagaacacgctggtgct
gaaaaccctaagtacatgatggatccagacatcaacgaatttaacaagtggcgcgatgct
tcagacggcatgctttgcaagatctcaatggctcctgaaagaaagggctcaaaggaattt
atccgcgaagctgttaaggaaggcgtagttatttcattaggtcactcaagcgcaaccttt
gaagaagcagttgaaggcgttgaagctggtgcaactatgtttactcacacctttaacggg
atgccagatccaagccaccacattccatcaatttcaaacgctgcaatggctttgaacaac
gtaactgacgaattaatctgtgatggtcaccacgttcaaccatcaatggctaagaccttg
atcaatgcagtaggtccagaacacattgctttaatcaccgactgtatggaagctggtatg
atgccagatggtgactacatgttgggtgaacttccagtttacgtaaaagacggtatggct
cgtcttaaggacggcgacaacttggctggttcaattttgcaattgaagcaagctatcaag
aatgtcgttgattggaacattgtaactccagaagaagcagtaatgatggccagctacgtt
ccagctaagagtgctcacatcttagacaagtgcggtactattgctccagataaagatgcc
gacttcttgatcttgaaccctgatatgactttgagtgaaacctacatgaatggtgaatca
agatacaaggcttaa

DBGET integrated database retrieval system