KEGG   Lactobacillus amylovorus GRL 1112: LA2_10505Help
Entry
LA2_10505         CDS       T01371                                 

Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase subunit 2
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
lam00473  D-Alanine metabolism
lam01100  Metabolic pathways
lam01503  Cationic antimicrobial peptide (CAMP) resistance
lam02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lam00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LA2_10505
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LA2_10505
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LA2_10505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:lam01504]
    LA2_10505
Enzymes [BR:lam01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     LA2_10505
Antimicrobial resistance genes [BR:lam01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    LA2_10505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: ADQ60002
UniProt: E4SNR1
Position
complement(2005468..2005707)
Genome map
AA seq 79 aa AA seqDB search
MDTKQGVLDILNDLTGEDLSDQMDENIFDNGLMDSMASVQMLLSLQEKFDIDVPVSEFKR
AEWDTPNKIVAKVESLENE
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggacactaaacaaggcgtattagacattttaaacgatttaactggtgaagatttatca
gatcaaatggatgaaaacatctttgacaatggtttgatggactcaatggcaagtgtacaa
atgcttttgagcttacaagaaaagtttgatattgatgttcccgtttcagaattcaagcgt
gctgaatgggatactccaaataagattgttgcaaaggtggaaagcttagaaaatgagtaa

DBGET integrated database retrieval system