KEGG   Lactobacillus amylovorus GRL 1112: LA2_10760Help
Entry
LA2_10760         CDS       T01371                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
lam  Lactobacillus amylovorus GRL 1112
Pathway
lam00030  Pentose phosphate pathway
lam00480  Glutathione metabolism
lam01100  Metabolic pathways
lam01110  Biosynthesis of secondary metabolites
lam01120  Microbial metabolism in diverse environments
lam01130  Biosynthesis of antibiotics
lam01200  Carbon metabolism
Module
lam_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LA2_10760
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LA2_10760
Enzymes [BR:lam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     LA2_10760
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     LA2_10760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ADQ60051
UniProt: E4SNW0
Position
complement(2058612..2060015)
Genome map
AA seq 467 aa AA seqDB search
MQQFGVIGLSVMGKNLALNVRNHGFSVSGYSIDKPEIDALAKYEDDKLKPCYTLEEFVNS
LEKPRKILIQIMAGAPVDETLHKLLPLLDKGDIVIDGGNSNYHDTNRRYHEMEKHGIHFI
GMGVSGGEEGALNGPALMPGGDEEAYKEVAPILEAIAAKNKEGKSCVSYMGPEGAGHYVK
MVHNGIEYAIMQEFSEVYSLLRDVAHKSDDEMSEIFDKWNHSVVQAYLSEITSKVLKQKD
DLTSDNIIDHILNVASYKGTGNWTLEDGVALGAPVTVIAEAVMARFMSKQTHLALESDIK
PTEFKYEGEIPEDLVDEFGKTLQLAQAVAYAQGFQELTMAAKAYNWDLRYKSIAQGWEAG
CIIRSAMLKDIENAYSNGKKLTNLFEDGYFRKLMEDNLPSLRKSVEFATKAGVPTPTLSA
ALNYLESIFNPKLPANMIQGQRDYFGAHTYLRNDRKGTFHTEWYEEK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaattcggcgttatcggtttgtctgttatgggcaaaaatcttgctttaaacgtt
agaaatcacggcttttcagtttcaggttattcaattgataaacctgaaattgatgcttta
gcaaaatacgaagatgacaagttaaagccatgctatacattggaagaatttgttaactca
cttgaaaagccacgtaaaattttgatccaaattatggctggtgctccagttgatgagacc
ttacataagttgcttccacttttggataaaggtgacatcgtgatcgatggtggtaactca
aactaccacgacactaaccgtcgttaccacgaaatggaaaagcatggcattcacttcatc
ggtatgggtgtttccggtggtgaagaaggtgccttaaatggtcctgctcttatgccaggt
ggtgacgaagaagcttacaaggaagttgctccaattcttgaagccattgctgctaagaac
aaagaaggtaagtcttgtgtaagttacatgggtcctgaaggtgcaggtcactacgtaaag
atggttcacaacggtattgaatatgccatcatgcaagaattctcagaagtttacagcctg
ctccgtgatgttgctcataagagtgacgatgaaatgtcagaaatctttgataagtggaac
cacagcgtggtacaagcttacttaagtgaaatcacttcaaaggttttgaagcaaaaggat
gatcttacttcagacaacatcattgatcacattttaaacgttgcttcatacaagggtact
ggtaactggactcttgaagatggtgtagctcttggtgcacctgtaacagttattgccgaa
gccgttatggcacgtttcatgagtaaacaaactcatttggcacttgaaagcgacattaag
ccaactgaatttaagtatgaaggtgaaatccctgaagacttagttgacgaattcggtaag
actttgcaattagctcaagctgtcgcatatgctcaaggtttccaagaattaactatggct
gctaaagcttacaactgggaccttagatacaagtcaattgcccaaggttgggaagccggc
tgtatcattcgttccgcaatgcttaaagatattgaaaatgcttactcaaatggcaagaag
cttactaacttgtttgaagatggttacttcagaaagttgatggaagacaaccttccatca
ttaagaaaatcagttgaatttgctacaaaggctggcgttccaacaccaactttgagcgca
gcactcaactacttggaatcaatcttcaatcccaaattgccagctaacatgatccaaggt
caacgtgactacttcggtgctcacacttaccttagaaatgaccgtaagggtacattccac
actgaatggtatgaagaaaaataa

DBGET integrated database retrieval system