KEGG   Lactobacillus amylolyticus: B1745_05025Help
Entry
B1745_05025       CDS       T05057                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lamy  Lactobacillus amylolyticus
Pathway
lamy00071  Fatty acid degradation
lamy00072  Synthesis and degradation of ketone bodies
lamy00280  Valine, leucine and isoleucine degradation
lamy00310  Lysine degradation
lamy00362  Benzoate degradation
lamy00620  Pyruvate metabolism
lamy00630  Glyoxylate and dicarboxylate metabolism
lamy00640  Propanoate metabolism
lamy00650  Butanoate metabolism
lamy00900  Terpenoid backbone biosynthesis
lamy01100  Metabolic pathways
lamy01110  Biosynthesis of secondary metabolites
lamy01120  Microbial metabolism in diverse environments
lamy01130  Biosynthesis of antibiotics
lamy01200  Carbon metabolism
lamy01212  Fatty acid metabolism
lamy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lamy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B1745_05025
   00630 Glyoxylate and dicarboxylate metabolism
    B1745_05025
   00640 Propanoate metabolism
    B1745_05025
   00650 Butanoate metabolism
    B1745_05025
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B1745_05025
   00072 Synthesis and degradation of ketone bodies
    B1745_05025
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B1745_05025
   00310 Lysine degradation
    B1745_05025
   00380 Tryptophan metabolism
    B1745_05025
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B1745_05025
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B1745_05025
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B1745_05025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lamy04147]
    B1745_05025
Enzymes [BR:lamy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B1745_05025
Exosome [BR:lamy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B1745_05025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARD07030
UniProt: A0A1V0JDT4
Position
complement(998245..999405)
Genome map
AA seq 386 aa AA seqDB search
MRDIYIVAAKRTPFGRYKGFFKDQTAVDLGVMALKGTLKAIDLDPAEVEAVFMGNVIAAG
LGENMARQVALNSGLPESTVATTVNDVCGSSLKAVRLAQGQMMMGDLDLVAVGGAESMTN
APYVLDKKDKENPSGHLRNTLFTDALIDAFSGQHMGVTAENVAEKYHISKEEMDRFSVES
HRKAVKAVEENAFADEILPITLNGETLAQDESIRPDTSMSALAKLKTVFKEGGKVTAGNA
SPLNDGASMLILATKEKCDQLGLKPLAKLGDFAEAGFDPSLMGYTPYFAVKKLLKKAKTQ
INDYDAFEVNEAFAAQAVALKRDLHIPADKLNILGGAIALGHPLGATGTRLIATAISDLK
KVNGQKALATLCIGGGQAIAYEIERV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagagatatttatattgttgcagccaaaagaacgccttttggtcgttataagggcttt
tttaaagatcaaactgccgttgatctcggcgtaatggccctaaaagggactttaaaagcc
attgatctggatccggctgaagttgaagctgtcttcatgggaaacgtcatagcagccggt
ttaggcgaaaatatggcgcggcaagtagcacttaattcaggtttgcctgaatctacggtc
gcaacaactgttaatgacgtctgtggctcgagtttaaaagcagttcgtctagctcaagga
cagatgatgatgggcgatctggatttggtagccgttggtggtgctgaaagcatgaccaat
gcaccgtatgtacttgacaaaaaagataaagaaaatccaagcggtcatttaagaaatact
ctgtttaccgatgctttgattgatgctttttccgggcaacacatgggtgtcacggcggaa
aacgttgctgagaagtatcatatttctaaagaagaaatggaccgttttagtgttgaatct
catagaaaagccgtcaaggcggttgaagagaatgcgtttgcggatgaaatattgccaatt
acgcttaatggcgagactttagctcaagatgagagcattcgtccggatacaagcatgtct
gccttagctaagctgaaaaccgtatttaaagaaggcggcaaagtgacagcgggcaacgct
tcacctttaaatgatggcgcaagcatgttgattttagctactaaagaaaaatgcgaccaa
ttaggtctaaagccacttgctaaacttggagacttcgcagaagctggatttgatccaagt
ttaatgggctatacgccatattttgccgttaaaaaattgctaaaaaaggctaaaacacaa
attaatgactatgatgcctttgaagttaatgaggcttttgcggcacaagctgtcgctctt
aaacgcgacttgcatatcccggctgataagctgaatatcttaggtggagcaattgcctta
ggccatcccttgggagcaacgggaacccgtctaattgcaacggcaatcagcgatttaaaa
aaggtaaacgggcaaaaggcattagccactctatgtatcggtggtggacaggcaattgcc
tatgaaatcgagcgcgtataa

DBGET integrated database retrieval system