KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0181Help
Entry
Lacal_0181        CDS       T01533                                 

Definition
(GenBank) Recombination protein recR
  KO
K06187  recombination protein RecR
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
lan03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lan00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lacal_0181
DNA repair and recombination proteins [BR:lan03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Lacal_0181
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Lacal_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HNF-1A_C zf-P11 HHH
Motif
Other DBs
NCBI-ProteinID: AEH00034
UniProt: F6GII6
Position
complement(191587..192309)
Genome map
AA seq 240 aa AA seqDB search
MLKNTKILHGVTLNINVFKDTKISESLHLYLNSQSMEFSSKLLENAVNEISQLPGIGKRT
ALRLALHLLKQPKEQTTNLSQAITHMREDLKFCRSCHNISDVDLCEICANPLRKKDVICV
VEDIRDVMAIENTASHKGLYHVLGGKINPIEGIGPHDLNIVSLIEKVKSGNIKELIFALS
PTMEGDTTNFYIFKQLQGLEVQTSTIARGISVGDELEYADEVTLGRSILNRIPFENSLKQ
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
ttgcttaaaaatactaaaatattacatggtgttactttaaatattaacgtatttaaagac
actaaaattagtgaaagtctgcacttatatttaaattcgcagtctatggaattctcatct
aaacttttggaaaatgctgttaacgaaatctcacaattaccaggtattggtaagcgtaca
gcattacgtttggcattacatttattaaaacaaccaaaagagcaaaccacaaatttatcg
caagcaattactcatatgcgagaagatttaaaattttgtagatcctgccataatattagc
gatgttgacttgtgtgaaatttgcgcaaatccattgcgaaaaaaagatgttatttgtgta
gttgaagatattcgcgacgttatggctatagaaaatacggcatcgcataaaggattgtat
cacgttttaggcggaaaaataaatcctatagaaggtattggaccacacgatttaaatatt
gtaagcttaatagaaaaagtaaaaagcggaaacattaaagaacttatttttgcattaagc
ccaactatggaaggcgatacaaccaacttttatatatttaaacaattacaaggtttagaa
gtacaaacctctacaatagccagaggaatatctgttggagatgagttagagtatgcagat
gaggtaacacttggacgcagtattttaaatcgtattccgtttgaaaactcattaaaacaa
taa

DBGET integrated database retrieval system