KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0763Help
Entry
Lacal_0763        CDS       T01533                                 

Definition
(GenBank) Cleaved adhesin domain protein
Organism
lan  Lacinutrix sp. 5H-3-7-4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cleaved_Adhesin Peptidase_M43 Reprolysin_3 Peptidase_M10 Reprolysin_5 Peptidase_M7 Calx-beta FadA
Motif
Other DBs
NCBI-ProteinID: AEH00612
UniProt: F6GEQ2
Position
874316..877147
Genome map
AA seq 943 aa AA seqDB search
MKKITFLLLLATVSFSANLFGQQKTPIQNTKRSIQQQIPAFEPTKETQNSLEQTGYARCL
TDENEIALQKQYPSRVNSAEFEAWIAPKLAQYKADRAAGKTMPPVFNIPVVIHIIHNGDP
INTNGLPGNENISDAQALSQIQVMNEDYRRLANTPGGANTTGLAQDIEINFCIAQQDPFG
SPTTGIVRHNITPPSNTSAATDDWETRADTENMKTTTQWDPEMYLNMWTIKAGGLPINQG
GQQGLLGYAQFPSNSGLAGINTNGGAANTDGVVASYDAMGTLAENDGSFILNNQYNLGRT
MTHEVGHWLGLRHIWGDGDCSADDFCADTPISGNPNYTCNLSADSCPTSAGNDQVQNYMD
YTNDACMDTFTQDQKDRMVIVMQNSPRRMQLNTSNTCSPASPTVNYTTTAPNSVIEGSDC
GFQDFTFQLSISSPTTATTTANLISTGSATINEDFDLLNNSVVFNAGTGFPSGNDTITLR
VYNDSFVETDEDITLEVNVTTTGDAIASTTPFTLTLVNDDIAATGSANTTIFTQDWEDTT
GWTIIDSDGDGENWGVFQPLTFGNLSGNWAGSVTDQSVVGGTGVLTPDNYIISPAITIGS
SATSVEFNYEIGAAGTPEHFAVYFTTDITDESTIIAGTLLEETNTIGGTTENRSVITSDS
NIVGQTGHLVFRHFNTTGNSLIMLDTINIIESINFVVQTEENIANPSTINVNTTGTAYSF
DNATGNIVAGLDNTGGFDYGCTTITVTRDQTIAGAPTVLRPGSTANEDRVMAKTISFTPE
NTNTSGQTTLSFYFTNAEITAWETITGESRNNLFAFREGTNVSEPVTVSDFNGDYILTVP
FTSGIDGNYYFGRQFNLSTPSFDLENSVSIFPNPTRNSLTISSKNNEIPSEYSVYNMLGQ
LITNKKINTEADLTLNTSALSNGVYFIKIAKDNAAITLRFIKE
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattacttttttacttttgcttgctaccgtaagtttttcagcaaacttattt
gggcaacaaaaaactcctattcaaaatactaaaagaagtatacagcagcagattccagca
tttgaacctacaaaagaaactcaaaactcactagaacaaactggatatgctcgatgctta
acagatgaaaatgagattgcattacaaaagcaatatcctagtcgtgtaaactctgcagaa
tttgaggcatggatcgctcctaaattagcacaatacaaagcagatagagctgcaggtaaa
acaatgcctccagtatttaacattccagtagtaattcatattattcataatggagaccca
attaacaccaatggtttacctggtaatgaaaatatctctgatgctcaagcattatctcaa
attcaagttatgaatgaagattacagacgtttagccaatactcctggcggagctaataca
actggtttagctcaagatattgaaataaatttttgtattgctcaacaagatccttttggc
agccctactactggtatagtacgtcacaacattactcctccaagtaatacaagtgctgct
acagatgattgggaaactagagcagatactgaaaacatgaaaactaccacgcaatgggat
ccagaaatgtacctaaatatgtggactataaaagctggtggcttaccaataaatcaaggt
ggtcaacaaggtcttttaggttatgctcaatttccaagtaattctggattagcgggaatt
aacactaacggtggagcagcaaatacagatggtgttgttgctagttatgatgccatgggt
actttagccgaaaatgatggatcttttatattaaacaaccaatataacttaggtcgtaca
atgactcacgaagttggtcactggttaggattacgtcacatttggggtgatggagattgt
agtgcagatgacttttgtgcagacacacctatttctggaaaccctaattacacttgtaat
ttgagtgccgattcttgcccaacaagtgctggtaatgatcaagtacaaaattatatggac
tatacaaacgatgcatgtatggacacctttacccaagatcaaaaagatcgtatggtaatt
gttatgcaaaattcgccaagacgtatgcaattaaatacttctaacacatgtagtcctgct
agtcctactgtaaactataccacaactgctcctaattctgttatagaaggaagtgattgc
ggttttcaagattttactttccagctgtcaatatcgtcacctactacagcaaccacaact
gctaatttaatctctactggttcggctacaattaatgaagatttcgatttattaaacaat
tctgttgtttttaatgcagggactggttttccaagtggaaatgacaccataacattaaga
gtttataacgatagttttgttgaaacagatgaagatataactctagaagtaaacgtaaca
actactggagatgccattgcatctacaacaccatttacacttactcttgttaatgatgat
attgctgcaacaggaagtgcaaatacaactatttttactcaagattgggaagacactacc
ggatggacaattatagatagtgatggtgatggtgaaaactggggtgtttttcaaccgctt
acttttggtaacctatctggtaattgggcaggttctgtaacagatcaatctgtagtagga
ggaacaggagtattaactccagataattatattatctctccagctattactataggttca
agtgctactagtgtagaattcaattacgaaattggagctgcaggtactcctgaacatttt
gctgtatatttcacaacagatattacagatgagtctactattattgcaggaactttactt
gaagaaacaaacacaattggtggcacaacagaaaacagatctgttattacaagtgattct
aacatagttggacaaacaggacatttagtatttagacattttaatactaccggtaactct
ttaattatgttagatacaattaatattatagagtctattaattttgttgtacaaacagaa
gaaaacatagcaaacccaagtactataaatgttaacacaacgggaactgcttattctttt
gacaatgcaactggaaacattgttgcaggattagataatacaggtggttttgattatggg
tgtacaactataactgtaacaagagaccaaacaatagcaggagctccaaccgtattacgc
cctggttctactgctaacgaagatagagttatggctaagacaataagttttactcctgaa
aacacgaatacttctggtcaaactacacttagtttctactttacaaatgctgaaattaca
gcatgggaaacaattaccggagaaagtagaaataatttatttgcctttagagaaggtaca
aatgtatctgaacctgttactgtttcagattttaatggagactacattttaacagtgcct
ttcacttctggaattgatggtaattactattttggtagacaatttaacttatctacacct
tcgtttgatttagaaaattcagtttctattttcccaaatccaacaagaaactcgttaaca
atttcatctaaaaacaacgagataccaagtgagtatagtgtttataatatgctaggacaa
ttaattacaaacaagaaaattaataccgaagcagatttaacattaaatactagtgcttta
agcaatggtgtgtattttattaagattgcaaaagataatgctgcaataactttacgcttt
attaaagagtaa

DBGET integrated database retrieval system